BTC (betacellulin)

Gene

• Entrez ID: 685
• Gene name: Betacellulin
• Gene symbol: BTC
• Synonyms (NCBI Gene): -
• Chromosome: 4
• Chromosome location: 4q13.3
• Summary: This gene encodes a member of the epidermal growth factor (EGF) family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the secreted grow

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022504	hsa-miR-124-3p	Microarray	18668037
MIRT023635	hsa-miR-1-3p	Microarray	18668037
MIRT024368	hsa-miR-215-5p	Microarray	19074876
MIRT026321	hsa-miR-192-5p	Microarray	19074876
MIRT437874	hsa-miR-200b-3p	ELISA, Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24762440
MIRT437874	hsa-miR-200b-3p	ELISA, Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24762440
MIRT437875	hsa-miR-200c-3p	ELISA, Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24762440
MIRT437875	hsa-miR-200c-3p	ELISA, Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24762440
MIRT445035	hsa-miR-4717-3p	PAR-CLIP	22100165
MIRT445033	hsa-miR-5589-3p	PAR-CLIP	22100165
MIRT445034	hsa-miR-585-5p	PAR-CLIP	22100165
MIRT445032	hsa-miR-5682	PAR-CLIP	22100165
MIRT445031	hsa-miR-3161	PAR-CLIP	22100165
MIRT445030	hsa-miR-1273e	PAR-CLIP	22100165
MIRT445029	hsa-miR-599	PAR-CLIP	22100165
MIRT445035	hsa-miR-4717-3p	PAR-CLIP	22100165
MIRT445033	hsa-miR-5589-3p	PAR-CLIP	22100165
MIRT445034	hsa-miR-585-5p	PAR-CLIP	22100165
MIRT445032	hsa-miR-5682	PAR-CLIP	22100165
MIRT445031	hsa-miR-3161	PAR-CLIP	22100165
MIRT445030	hsa-miR-1273e	PAR-CLIP	22100165
MIRT445029	hsa-miR-599	PAR-CLIP	22100165
MIRT445035	hsa-miR-4717-3p	PAR-CLIP	22100165
MIRT445033	hsa-miR-5589-3p	PAR-CLIP	22100165
MIRT445034	hsa-miR-585-5p	PAR-CLIP	22100165
MIRT445032	hsa-miR-5682	PAR-CLIP	22100165
MIRT445031	hsa-miR-3161	PAR-CLIP	22100165
MIRT445030	hsa-miR-1273e	PAR-CLIP	22100165
MIRT445029	hsa-miR-599	PAR-CLIP	22100165
MIRT445035	hsa-miR-4717-3p	PAR-CLIP	22100165
MIRT445033	hsa-miR-5589-3p	PAR-CLIP	22100165
MIRT445034	hsa-miR-585-5p	PAR-CLIP	22100165
MIRT445032	hsa-miR-5682	PAR-CLIP	22100165
MIRT445031	hsa-miR-3161	PAR-CLIP	22100165
MIRT445030	hsa-miR-1273e	PAR-CLIP	22100165
MIRT445029	hsa-miR-599	PAR-CLIP	22100165
MIRT2183096	hsa-miR-4760-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005154	Function	Epidermal growth factor receptor binding	IBA
GO:0005154	Function	Epidermal growth factor receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	19740107, 25416956, 25910212, 26871637, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	9168114, 12399441
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IBA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IDA	8144591
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IEA
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	TAS	8439318
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0016020	Component	Membrane	IEA
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IDA	9168114, 12399441
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IEA
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0035810	Process	Positive regulation of urine volume	IEA
GO:0038134	Process	ERBB2-EGFR signaling pathway	IEA
GO:0038138	Process	ERBB4-ERBB4 signaling pathway	IDA	9168114
GO:0045597	Process	Positive regulation of cell differentiation	IEA
GO:0045840	Process	Positive regulation of mitotic nuclear division	IBA
GO:0045840	Process	Positive regulation of mitotic nuclear division	IEA
GO:0048018	Function	Receptor ligand activity	IDA	9168114, 12399441
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048018	Function	Receptor ligand activity	TAS	8144591
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0051781	Process	Positive regulation of cell division	IEA
GO:1904019	Process	Epithelial cell apoptotic process	IEA
GO:1904036	Process	Negative regulation of epithelial cell apoptotic process	IEA

Other IDs

• MIM: 600345
• HGNC: 1121
• e!Ensembl: ENSG00000174808

Protein

• UniProt ID: P35070
• Protein name: Probetacellulin [Cleaved into: Betacellulin (BTC)]
• Protein function: Growth factor that binds to EGFR, ERBB4 and other EGF receptor family members. Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells.
• PDB: 1IOX, 1IP0, 8U4J, 8U4K
• Tissue specificity: TISSUE SPECIFICITY: Synthesized in several tissues and tumor cells. Predominantly expressed in pancreas and small intestine. {ECO:0000269|PubMed:8919026}.
• Sequence:

  MDRAARCSGASSLPLLLALALGLVILHCVVADGNSTRSPETNGLLCGDPEENCAATTTQS
  KRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQIL
  VICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA

• Sequence length: 178

Pathways

KEGG:

ErbB signaling pathway

Reactome:

Signaling by ERBB2
Signaling by ERBB4
SHC1 events in ERBB2 signaling
PI3K events in ERBB4 signaling
SHC1 events in ERBB4 signaling
PIP3 activates AKT signaling
Signaling by EGFR
GRB2 events in EGFR signaling
GAB1 signalosome
SHC1 events in EGFR signaling
EGFR downregulation
GRB2 events in ERBB2 signaling
PI3K events in ERBB2 signaling
EGFR interacts with phospholipase C-gamma
Constitutive Signaling by Aberrant PI3K in Cancer
Inhibition of Signaling by Overexpressed EGFR
RAF/MAP kinase cascade
ERBB2 Regulates Cell Motility
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
ERBB2 Activates PTK6 Signaling
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis
Downregulation of ERBB2 signaling
Extra-nuclear estrogen signaling
Estrogen-dependent nuclear events downstream of ESR-membrane signaling
Signaling by ERBB2 KD Mutants
Signaling by ERBB2 TMD/JMD mutants