Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6847
Gene name Gene Name - the full gene name approved by the HGNC.	Synaptonemal complex protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SYCP1
Synonyms (NCBI Gene) Gene synonyms aliases	CT8, HOM-TES-14, SCP-1, SCP1
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p13.2

Show/Hide all(9)

miRTarBase ID	miRNA	Experiments	Reference
MIRT054241	hsa-miR-124-3p	Flow cytometry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23548312
MIRT054241	hsa-miR-124-3p	Luciferase reporter assay	23313552
MIRT438804	hsa-miR-96-5p	Luciferase reporter assay	23313552
MIRT054241	hsa-miR-124-3p	Luciferase reporter assay	23313552
MIRT438804	hsa-miR-96-5p	Luciferase reporter assay	23313552
MIRT2121533	hsa-miR-1179	CLIP-seq
MIRT2121534	hsa-miR-1264	CLIP-seq
MIRT2121535	hsa-miR-4719	CLIP-seq
MIRT2121536	hsa-miR-586	CLIP-seq

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000711	Process	Meiotic DNA repair synthesis	IBA	21873635
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000795	Component	Synaptonemal complex	ISS
GO:0000801	Component	Central element	IBA	21873635
GO:0000802	Component	Transverse filament	IBA	21873635
GO:0001673	Component	Male germ cell nucleus	IBA	21873635
GO:0003677	Function	DNA binding	TAS	1464329
GO:0003690	Function	Double-stranded DNA binding	IBA	21873635
GO:0003690	Function	Double-stranded DNA binding	IDA	29915389
GO:0005694	Component	Chromosome	ISS
GO:0007129	Process	Homologous chromosome pairing at meiosis	ISS
GO:0007130	Process	Synaptonemal complex assembly	ISS	15944401
GO:0007131	Process	Reciprocal meiotic recombination	ISS
GO:0007283	Process	Spermatogenesis	TAS	1464329
GO:0032880	Process	Regulation of protein localization	IEA
GO:0035092	Process	Sperm chromatin condensation	IEA
GO:0051026	Process	Chiasma assembly	IBA	21873635
GO:0051289	Process	Protein homotetramerization	IDA	29915389
GO:0051301	Process	Cell division	IEA
GO:0051878	Process	Lateral element assembly	IBA	21873635

MIM	HGNC	e!Ensembl
602162	11487	ENSG00000198765

Protein

UniProt ID

Q15431

Protein name

Synaptonemal complex protein 1 (SCP-1) (Cancer/testis antigen 8) (CT8)

Protein function

Major component of the transverse filaments of synaptonemal complexes, formed between homologous chromosomes during meiotic prophase. Required for normal assembly of the central element of the synaptonemal complexes. Required for normal centrome

PDB

4YTO , 6F5X , 6F62 , 6F63 , 6F64

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05483	SCP-1	28 → 792	Synaptonemal complex protein 1 (SCP-1)	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Testis. {ECO:0000269|PubMed:9371398}.

Sequence

MEKQKPFALFVPPRSSSSQVSAVKPQTLGGDSTFFKSFNKCTEDDFEFPFAKTNLSKNGE
NIDSDPALQKVNFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWK
VSTEAELRQKESKLQENRKIIEAQRKAIQELQFGNEKVSLKLEEGIQENKDLIKENNATR
HLCNLLKETCARSAEKTKKYEYEREETRQVYMDLNNNIEKMITAFEELRVQAENSRLEMH
FKLKEDYEKIQHLEQEYKKEINDKEKQVSLLLIQITEKENKMKDLTFLLEESRDKVNQLE
EKTKLQSENLKQSIEKQHHLTKELEDIKVSLQRSVSTQKALEEDLQIATKTICQLTEEKE
TQMEESNKARAAHSFVVTEFETTVCSLEELLRTEQQRLEKNEDQLKILTMELQKKSSELE
EMTKLTNNKEVELEELKKVLGEKETLLYENKQFEKIAEELKGTEQELIGLLQAREKEVHD
LEIQLTAITTSEQYYSKEVKDLKTELENEKLKNTELTSHCNKLSLENKELTQETSDMTLE
LKNQQEDINNNKKQEERMLKQIENLQETETQLRNELEYVREELKQKRDEVKCKLDKSEEN
CNNLRKQVENKNKYIEELQQENKALKKKGTAESKQLNVYEIKVNKLELELESAKQKFGEI
TDTYQKEIEDKKISEENLLEEVEKAKVIADEAVKLQKEIDKRCQHKIAEMVALMEKHKHQ
YDKIIEERDSELGLYKSKEQEQSSLRASLEIELSNLKAELLSVKKQLEIEREEKEKLKRE
AKENTATLKEKKDKKTQTFLLETPEIYWKLDSKAVPSQTVSRNFTSVDHGISKDKRDYLW
TSAKNTLSTPLPKAYTVKTPTKPKLQQRENLNIPIEESKKKRKMAFEFDINSDSSETTDL
LSMVSEEETLKTLYRNNNPPASHLCVKTPKKAPSSLTTPGSTLKFGAIRKMREDRWAVIA
KMDRKKKLKEAEKLFV

Sequence length

976

Interactions

View interactions

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Adenocarcinoma	Adenocarcinoma, Adenocarcinoma, Basal Cell, Adenocarcinoma, Oxyphilic, Adenocarcinoma, Tubular	rs121913530, rs886039394, rs121913474	14991579
Carcinoma	Carcinoma, Cribriform, Carcinoma, Granular Cell	rs121912654, rs555607708, rs786202962, rs1564055259	14991579
Pancreatic cancer	Malignant neoplasm of pancreas	rs118203998, rs180177143, rs587776417, rs587776527, rs864622498, rs876659571, rs587778587, rs886039619, rs745533713, rs1555460431	14991579

Show/Hide Text Mining Associations (22)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	11531257
Carcinoma Renal Cell	Associate	9560255
Colorectal Neoplasms	Associate	15756003, 39208330
general anxiety disorder	Associate	36344488
Glioma	Associate	9560255
Hereditary Breast and Ovarian Cancer Syndrome	Associate	9560255
Infertility	Associate	18706547
Intracranial Aneurysm	Associate	35228681
Leukemia Lymphocytic Chronic B Cell	Associate	10584877
Leukemia Myeloid Acute	Associate	21898529
Lymphoma T Cell Cutaneous	Associate	11149944, 24850846, 25779945
Lymphoma T Cell Peripheral	Associate	16030183
Multiple Myeloma	Associate	10584877
Mycosis Fungoides	Associate	25779945
Neoplasms	Associate	11149944, 11531257, 16030183, 16929165, 9560255
Obsessive Compulsive Disorder	Associate	36344488
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	10584877
Sezary Syndrome	Associate	25779945
Squamous Cell Carcinoma of Head and Neck	Associate	16929165
Stomach Neoplasms	Stimulate	11531257
Testicular Germ Cell Tumor	Associate	11454979
Testicular Neoplasms	Associate	16030183, 39208330

SYCP1 (synaptonemal complex protein 1)