Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	6832
Gene name	Suv3 like RNA helicase
Gene symbol	SUPV3L1
Synonyms (NCBI Gene)	SUV3
Chromosome	10
Chromosome location	10q22.1

Show/Hide all (4)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027436	hsa-miR-98-5p	Microarray	19088304
MIRT046569	hsa-miR-200b-3p	CLASH	23622248
MIRT046174	hsa-miR-27b-3p	CLASH	23622248
MIRT044646	hsa-miR-320a	CLASH	23622248

Show/Hide all (45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000957	Process	Mitochondrial RNA catabolic process	TAS
GO:0000958	Process	Mitochondrial mRNA catabolic process	IMP	19864255, 22661577
GO:0000962	Process	Positive regulation of mitochondrial RNA catabolic process	IDA	19509288, 29967381
GO:0000962	Process	Positive regulation of mitochondrial RNA catabolic process	IMP	19864255
GO:0000965	Process	Mitochondrial RNA 3'-end processing	IBA
GO:0000965	Process	Mitochondrial RNA 3'-end processing	IMP	19864255
GO:0003677	Function	DNA binding	IMP	12466530
GO:0003678	Function	DNA helicase activity	IMP	12466530
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	TAS	9925937
GO:0003724	Function	RNA helicase activity	IDA	19509288
GO:0003724	Function	RNA helicase activity	IEA
GO:0003725	Function	Double-stranded RNA binding	IDA	19509288
GO:0004386	Function	Helicase activity	IEA
GO:0004386	Function	Helicase activity	TAS	9925937
GO:0005515	Function	Protein binding	IPI	17961633, 19509288, 25416956, 28514442, 29967381, 32296183, 33961781, 39251607
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	17352692
GO:0005634	Component	Nucleus	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	17352692, 19864255
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	TAS	9925937
GO:0005759	Component	Mitochondrial matrix	IDA	12466530
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006310	Process	DNA recombination	IMP	17961633
GO:0006401	Process	RNA catabolic process	IMP	18678873
GO:0007005	Process	Mitochondrion organization	IMP	19864255
GO:0016787	Function	Hydrolase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0030307	Process	Positive regulation of cell growth	IMP	19864255
GO:0034458	Function	3'-5' RNA helicase activity	EXP	15096047, 19509288, 35481630
GO:0034458	Function	3'-5' RNA helicase activity	IDA	19509288
GO:0035945	Process	Mitochondrial ncRNA surveillance	IMP	19864255
GO:0035946	Process	Mitochondrial mRNA surveillance	IMP	19864255
GO:0042645	Component	Mitochondrial nucleoid	IDA	18063578
GO:0042645	Component	Mitochondrial nucleoid	IEA
GO:0042802	Function	Identical protein binding	IPI	19509288, 39251607
GO:0042803	Function	Protein homodimerization activity	IPI	19509288
GO:0043066	Process	Negative regulation of apoptotic process	IMP	17352692
GO:0045025	Component	Mitochondrial degradosome	IBA
GO:0045025	Component	Mitochondrial degradosome	IDA	19509288, 29967381
GO:2000827	Process	Mitochondrial RNA surveillance	IMP	19864255

MIM	HGNC	e!Ensembl
605122	11471	ENSG00000156502

Q8IYB8

Protein name

ATP-dependent RNA helicase SUPV3L1, mitochondrial (EC 3.6.4.13) (Suppressor of var1 3-like protein 1) (SUV3-like protein 1)

Protein function

Major helicase player in mitochondrial RNA metabolism. Component of the mitochondrial degradosome (mtEXO) complex, that degrades 3' overhang double-stranded RNA with a 3'-to-5' directionality in an ATP-dependent manner. Involved in the degradati

PDB

3RC3 , 3RC8 , 7W1R

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18114	Suv3_N	62 → 179	Suv3 helical N-terminal domain	Domain
PF00271	Helicase_C	352 → 475	Helicase conserved C-terminal domain	Family
PF18147	Suv3_C_1	556 → 598	Suv3 C-terminal domain 1	Domain
PF12513	SUV3_C	625 → 672	Mitochondrial degradasome RNA helicase subunit C terminal	Family

Tissue specificity

TISSUE SPECIFICITY: Broadly expressed. {ECO:0000269|PubMed:10453991}.

Sequence

MSFSRALLWARLPAGRQAGHRAAICSALRPHFGPFPGVLGQVSVLATASSSASGGSKIPN
TSLFVPLTVKPQGPSADGDVGAELTRPLDKNEVKKVLDKFYKRKEIQKLGADYGLDARLF
HQAFISFRNYIMQSHSLDVDIHIVLNDICFGAAHADDLFPFFLRHAKQIFPVLDCKDDLR
KISDLRIPPNWYPDARAMQRKIIFHSGPTNSGKTYHAIQKYFSAKSGVYCGPLKLLAHEI
FEKSNAAGVPCDLVTGEERVTVQPNGKQASHVSCTVEMCSVTTPYEVAVIDEIQMIRDPA
RGWAWTRALLGLCAEEVHLCGEPAAIDLVMELMYTTGEEVEVRDYKRLTPISVLDHALES
LDNLRPGDCIVCFSKNDIYSVSRQIEIRGLESAVIYGSLPPGTKLAQAKKFNDPNDPCKI
LVATDAIGMGLNLSIRRIIFYSLIKPSINEKGERELEPITTSQALQIAGRAGRFSSRFKE
GEVTTMNHEDLSLLKEILKRPVDPIRAAGLHPTAEQIEMFAYHLPDATLSNLIDIFVDFS
QVDGQYFVCNMDDFKFSAELIQHIPLSLRVRYVFCTAPINKKQPFVCSSLLQFARQYSRN
EPLTFAWLRRYIKWPLLPPKNIKDLMDLEAVHDVLDLYLWLSYRFMDMFPDASLIRDLQK
ELDGIIQDGVHNITKLIKMSETHKLLNLEGFPSGSQSRLSGTLKSQARRTRGTKALGSKA
TEPPSPDAGELSLASRLVQQGLLTPDMLKQLEKEWMTQQTEHNKEKTESGTHPKGTRRKK
KEPDSD

Sequence length

786

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	rs2539852229	RCV004557974

Show/Hide Text Mining Associations (24)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Ataxia	Associate	39596606
Autoimmune Diseases	Associate	35023579
Calcinosis	Associate	35023579
Cognition Disorders	Associate	39596606
Congenital Abnormalities	Associate	35023579
Epithelial Recurrent Erosion Dystrophy	Associate	35023579
Fetal Growth Retardation	Associate	35023579
Gait Ataxia	Associate	39596606
Heredodegenerative Disorders Nervous System	Associate	35023579
Hypopigmentation	Associate	35023579, 39596606
Intervertebral Disc Displacement	Associate	31455417
Mitochondrial Diseases	Associate	35023579, 39596606
Muscle Spasticity	Associate	39596606
Neurodegenerative Diseases	Associate	39596606
Nystagmus Pathologic	Associate	39596606
Optic Atrophy	Associate	35023579, 39596606
Paraparesis Spastic	Associate	35023579, 39596606
Photophobia	Associate	35023579
Pulmonary Disease Chronic Obstructive	Associate	36899372
Retinitis Pigmentosa	Associate	35023579
RNA Virus Infections	Associate	35023579
Skin Diseases	Associate	39596606
Spinocerebellar ataxia autosomal recessive 5	Associate	39596606
Stomach Neoplasms	Associate	32164594

SUPV3L1 (Suv3 like RNA helicase)