Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6819
Gene name	Sulfotransferase family 1C member 2
Gene symbol	SULT1C2
Synonyms (NCBI Gene)	ST1C1ST1C2SULT1C1humSULTC2
Chromosome	2
Chromosome location	2q12.3
Summary	Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and

Show/Hide all (35)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019095	hsa-miR-335-5p	Microarray	18185580
MIRT025896	hsa-miR-7-5p	Microarray	19073608
MIRT1402856	hsa-miR-1224-3p	CLIP-seq
MIRT1402857	hsa-miR-1260	CLIP-seq
MIRT1402858	hsa-miR-1260b	CLIP-seq
MIRT1402859	hsa-miR-1280	CLIP-seq
MIRT1402860	hsa-miR-188-3p	CLIP-seq
MIRT1402861	hsa-miR-3156-3p	CLIP-seq
MIRT1402862	hsa-miR-3938	CLIP-seq
MIRT1402863	hsa-miR-410	CLIP-seq
MIRT1402864	hsa-miR-889	CLIP-seq
MIRT1402865	hsa-miR-1295	CLIP-seq
MIRT1402866	hsa-miR-186	CLIP-seq
MIRT1402867	hsa-miR-208a	CLIP-seq
MIRT1402868	hsa-miR-208b	CLIP-seq
MIRT1402869	hsa-miR-223	CLIP-seq
MIRT1402870	hsa-miR-3667-5p	CLIP-seq
MIRT1402871	hsa-miR-3672	CLIP-seq
MIRT1402872	hsa-miR-3940-5p	CLIP-seq
MIRT1402873	hsa-miR-4252	CLIP-seq
MIRT1402874	hsa-miR-4274	CLIP-seq
MIRT1402875	hsa-miR-4499	CLIP-seq
MIRT1402876	hsa-miR-4507	CLIP-seq
MIRT1402877	hsa-miR-4717-5p	CLIP-seq
MIRT1402878	hsa-miR-4724-5p	CLIP-seq
MIRT1402879	hsa-miR-4753-5p	CLIP-seq
MIRT1402880	hsa-miR-4795-3p	CLIP-seq
MIRT1402881	hsa-miR-499-5p	CLIP-seq
MIRT1402882	hsa-miR-935	CLIP-seq
MIRT2636655	hsa-miR-1302	CLIP-seq
MIRT2636656	hsa-miR-4298	CLIP-seq
MIRT2636657	hsa-miR-4747-5p	CLIP-seq
MIRT2636655	hsa-miR-1302	CLIP-seq
MIRT2636656	hsa-miR-4298	CLIP-seq
MIRT2636657	hsa-miR-4747-5p	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004062	Function	Aryl sulfotransferase activity	IBA
GO:0004062	Function	Aryl sulfotransferase activity	IDA	10783263
GO:0004062	Function	Aryl sulfotransferase activity	IEA
GO:0005515	Function	Protein binding	IPI	21044950
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	9169148
GO:0005739	Component	Mitochondrion	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0008146	Function	Sulfotransferase activity	IDA	19548878, 20056724
GO:0008146	Function	Sulfotransferase activity	IEA
GO:0008146	Function	Sulfotransferase activity	TAS	9169148
GO:0009308	Process	Amine metabolic process	TAS	9169148
GO:0016740	Function	Transferase activity	IEA
GO:0051922	Function	Cholesterol sulfotransferase activity	IEA
GO:0051923	Process	Sulfation	IBA
GO:0051923	Process	Sulfation	IDA	19548878
GO:0051923	Process	Sulfation	IDA	10783263, 20056724
GO:0051923	Process	Sulfation	IEA

MIM	HGNC	e!Ensembl
602385	11456	ENSG00000198203

O00338

Protein name

Sulfotransferase 1C2 (ST1C2) (EC 2.8.2.1) (Sulfotransferase 1C1) (SULT1C#1) (humSULTC2)

Protein function

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) to catalyze the sulfate conjugation of phenolic compounds (PubMed:10481272, PubMed:10783263, PubMed:9852044). Does not transfer sulfate to steroids, dopamine, acetaminophen, or

PDB

3BFX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00685	Sulfotransfer_1	39 → 289	Sulfotransferase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Found in adult stomach, kidney and thyroid gland, and in fetal kidney and liver.

Sequence

MALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVD
MIEQNGDVEKCQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFW
ENNCKFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGW
WEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTN
RSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL

Sequence length

296

Interactions

View interactions

	Reactome
			Cytosolic sulfonation of small molecules

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (1)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Spinal Dysraphism	Associate	38526198	★★★★★ ★☆☆☆☆ Found in Text Mining only

SULT1C2 (sulfotransferase family 1C member 2)