Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6817
Gene name Gene Name - the full gene name approved by the HGNC.	Sulfotransferase family 1A member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SULT1A1
Synonyms (NCBI Gene) Gene synonyms aliases	HAST1/HAST2, P-PST, P-PST 1, PST, ST1A1, ST1A3, STP, STP1, TSPST1, ts-PST
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16p11.2
Summary Summary of gene provided in NCBI Entrez Gene.	Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and

Show/Hide all(13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004760	hsa-miR-631	Luciferase reporter assay, qRT-PCR, Western blot	20881232
MIRT004760	hsa-miR-631	Luciferase reporter assay, qRT-PCR, Western blot	20881232
MIRT1402802	hsa-miR-1343	CLIP-seq
MIRT1402803	hsa-miR-216a	CLIP-seq
MIRT1402804	hsa-miR-378g	CLIP-seq
MIRT1402805	hsa-miR-4423-5p	CLIP-seq
MIRT1402806	hsa-miR-4437	CLIP-seq
MIRT1402807	hsa-miR-4674	CLIP-seq
MIRT1402808	hsa-miR-4726-3p	CLIP-seq
MIRT1402809	hsa-miR-4781-3p	CLIP-seq
MIRT1402805	hsa-miR-4423-5p	CLIP-seq
MIRT1402808	hsa-miR-4726-3p	CLIP-seq
MIRT1402809	hsa-miR-4781-3p	CLIP-seq

Show/Hide all(29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004062	Function	Aryl sulfotransferase activity	IBA
GO:0004062	Function	Aryl sulfotransferase activity	IDA	8093002, 12471039, 23207770
GO:0004062	Function	Aryl sulfotransferase activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 25910212, 31515488, 32152050, 33961781
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006068	Process	Ethanol catabolic process	IDA	23207770
GO:0006584	Process	Catecholamine metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	IDA	12471039, 20056724
GO:0008146	Function	Sulfotransferase activity	IDA	10199779, 19548878
GO:0008146	Function	Sulfotransferase activity	IEA
GO:0008146	Function	Sulfotransferase activity	TAS	8661000
GO:0008202	Process	Steroid metabolic process	IEA
GO:0008210	Process	Estrogen metabolic process	IDA	16221673
GO:0009308	Process	Amine metabolic process	TAS	8661000
GO:0009812	Process	Flavonoid metabolic process	IDA	20056724
GO:0016740	Function	Transferase activity	IEA
GO:0042403	Process	Thyroid hormone metabolic process	IDA	10199779
GO:0042420	Process	Dopamine catabolic process	IDA	8093002
GO:0047894	Function	Flavonol 3-sulfotransferase activity	IDA	20056724
GO:0050294	Function	Steroid sulfotransferase activity	IDA	16221673
GO:0050427	Process	3'-phosphoadenosine 5'-phosphosulfate metabolic process	IDA	12471039, 23207770
GO:0050656	Function	3'-phosphoadenosine 5'-phosphosulfate binding	IDA	12471039
GO:0051923	Process	Sulfation	IBA
GO:0051923	Process	Sulfation	IDA	19548878
GO:0051923	Process	Sulfation	IDA	10199779, 20056724, 23207770

MIM	HGNC	e!Ensembl
171150	11453	ENSG00000196502

Protein

UniProt ID

P50225

Protein name

Sulfotransferase 1A1 (ST1A1) (EC 2.8.2.1) (Aryl sulfotransferase 1) (HAST1/HAST2) (Phenol sulfotransferase 1) (Phenol-sulfating phenol sulfotransferase 1) (P-PST 1) (ST1A3) (Thermostable phenol sulfotransferase) (Ts-PST)

Protein function

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of a wide variety of acceptor molecules bearing a hydroxyl or an amine group. Sulfonation increases the water solubility

PDB

1LS6 , 1Z28 , 2D06 , 3QVU , 3QVV , 3U3J , 3U3K , 3U3M , 3U3O , 3U3R , 4GRA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00685	Sulfotransfer_1	38 → 288	Sulfotransferase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Liver, lung, adrenal, brain, platelets and skin.

Sequence

MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDM
IYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLD
QKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWW
ELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNY
TTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

Sequence length

295

Interactions

View interactions

	KEGG		Reactome
	Chemical carcinogenesis - DNA adducts		Cytosolic sulfonation of small molecules

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Inflammatory Bowel Disease	Inflammatory bowel disease (MTAG)	N/A	N/A	GWAS

Show/Hide Text Mining Associations (39)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Addison Disease	Stimulate	37807083
Adenocarcinoma	Associate	26482433
Adenocarcinoma of Lung	Associate	39257908
Alcoholism	Associate	23775849
Arthritis Juvenile	Associate	34963488
Brain Neoplasms	Associate	17605044
Breast Neoplasms	Associate	15318931, 15743503, 16080486, 16280036, 19308726, 22708928, 25648141, 27221864, 36203093
Breast Neoplasms Male	Associate	23711090
Carcinoma Hepatocellular	Associate	19906068, 25654087, 28634336, 36914816
Colorectal Neoplasms	Associate	16425401, 17603900, 18990750, 26482433
Drug Related Side Effects and Adverse Reactions	Associate	27221864
Endometrial Neoplasms	Associate	18318428
Fatty Liver	Associate	14606109
Fibrocystic Breast Disease	Associate	23711090
Fibrosis	Associate	19906068
Glioma	Associate	17605044
Hepatitis B Chronic	Stimulate	19906068
Infections	Associate	26906565
Inflammation	Associate	37342340
Inflammatory Breast Neoplasms	Associate	25811737
Leukemia	Associate	25514600, 25992585
Leukemia Myeloid Acute	Associate	16763210, 25992585
Lown Ganong Levine Syndrome	Associate	15318931
Lung Neoplasms	Associate	22524828, 29110586
Menstruation Disturbances	Associate	27221864
Neoplasms	Associate	15318931, 16280036, 17605044, 21791872, 22253860, 25514600, 28634336, 30215795, 32727562
Neoplasms	Stimulate	22253860
Neoplasms Multiple Primary	Associate	22253860
Non alcoholic Fatty Liver Disease	Inhibit	23223517
Obesity	Associate	26449484
Polypoidal Choroidal Vasculopathy	Associate	23711090
Precancerous Conditions	Associate	14648207
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	25992585
Prostatic Neoplasms	Associate	19654868
Sleep Initiation and Maintenance Disorders	Associate	27300114
Smoke Inhalation Injury	Associate	18499698
Urethral Neoplasms	Associate	14648207, 17619904, 25103078
Urinary Bladder Neoplasms	Associate	26854433
Vaginal Discharge	Associate	27221864

SULT1A1 (sulfotransferase family 1A member 1)