SULT1A1 (sulfotransferase family 1A member 1)

Gene

• Entrez ID: 6817
• Gene name: Sulfotransferase family 1A member 1
• Gene symbol: SULT1A1
• Synonyms (NCBI Gene): HAST1/HAST2, P-PST, P-PST 1, PST, ST1A1, ST1A3, STP, STP1, TSPST1, ts-PST
• Chromosome: 16
• Chromosome location: 16p11.2
• Summary: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004760	hsa-miR-631	Luciferase reporter assay, qRT-PCR, Western blot	20881232
MIRT004760	hsa-miR-631	Luciferase reporter assay, qRT-PCR, Western blot	20881232
MIRT1402802	hsa-miR-1343	CLIP-seq
MIRT1402803	hsa-miR-216a	CLIP-seq
MIRT1402804	hsa-miR-378g	CLIP-seq
MIRT1402805	hsa-miR-4423-5p	CLIP-seq
MIRT1402806	hsa-miR-4437	CLIP-seq
MIRT1402807	hsa-miR-4674	CLIP-seq
MIRT1402808	hsa-miR-4726-3p	CLIP-seq
MIRT1402809	hsa-miR-4781-3p	CLIP-seq
MIRT1402805	hsa-miR-4423-5p	CLIP-seq
MIRT1402808	hsa-miR-4726-3p	CLIP-seq
MIRT1402809	hsa-miR-4781-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004062	Function	Aryl sulfotransferase activity	IBA
GO:0004062	Function	Aryl sulfotransferase activity	IDA	8093002, 12471039, 23207770
GO:0004062	Function	Aryl sulfotransferase activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 25910212, 31515488, 32152050, 33961781
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006068	Process	Ethanol catabolic process	IDA	23207770
GO:0006584	Process	Catecholamine metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	IDA	12471039, 20056724
GO:0008146	Function	Sulfotransferase activity	IDA	10199779, 19548878
GO:0008146	Function	Sulfotransferase activity	IEA
GO:0008146	Function	Sulfotransferase activity	TAS	8661000
GO:0008202	Process	Steroid metabolic process	IEA
GO:0008210	Process	Estrogen metabolic process	IDA	16221673
GO:0009308	Process	Amine metabolic process	TAS	8661000
GO:0009812	Process	Flavonoid metabolic process	IDA	20056724
GO:0016740	Function	Transferase activity	IEA
GO:0042403	Process	Thyroid hormone metabolic process	IDA	10199779
GO:0042420	Process	Dopamine catabolic process	IDA	8093002
GO:0047894	Function	Flavonol 3-sulfotransferase activity	IDA	20056724
GO:0050294	Function	Steroid sulfotransferase activity	IDA	16221673
GO:0050427	Process	3'-phosphoadenosine 5'-phosphosulfate metabolic process	IDA	12471039, 23207770
GO:0050656	Function	3'-phosphoadenosine 5'-phosphosulfate binding	IDA	12471039
GO:0051923	Process	Sulfation	IBA
GO:0051923	Process	Sulfation	IDA	19548878
GO:0051923	Process	Sulfation	IDA	10199779, 20056724, 23207770

Other IDs

• MIM: 171150
• HGNC: 11453
• e!Ensembl: ENSG00000196502

Protein

• UniProt ID: P50225
• Protein name: Sulfotransferase 1A1 (ST1A1) (EC 2.8.2.1) (Aryl sulfotransferase 1) (HAST1/HAST2) (Phenol sulfotransferase 1) (Phenol-sulfating phenol sulfotransferase 1) (P-PST 1) (ST1A3) (Thermostable phenol sulfotransferase) (Ts-PST)
• Protein function: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of a wide variety of acceptor molecules bearing a hydroxyl or an amine group. Sulfonation increases the water solubility
• PDB: 1LS6, 1Z28, 2D06, 3QVU, 3QVV, 3U3J, 3U3K, 3U3M, 3U3O, 3U3R, 4GRA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00685	Sulfotransfer_1	38 → 288	Sulfotransferase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Liver, lung, adrenal, brain, platelets and skin.
• Sequence:

  MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDM
  IYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLD
  QKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWW
  ELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNY
  TTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

• Sequence length: 295

Pathways

KEGG:

Chemical carcinogenesis - DNA adducts

Reactome:

Cytosolic sulfonation of small molecules