SULT1A2 (sulfotransferase family 1A member 2)

Gene

• Entrez ID: 6799
• Gene name: Sulfotransferase family 1A member 2
• Gene symbol: SULT1A2
• Synonyms (NCBI Gene): HAST4, P-PST, P-PST 2, ST1A2, STP2, TSPST2
• Chromosome: 16
• Chromosome location: 16p11.2
• Summary: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004062	Function	Aryl sulfotransferase activity	IBA
GO:0004062	Function	Aryl sulfotransferase activity	IDA	20417180, 23207770
GO:0004062	Function	Aryl sulfotransferase activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006068	Process	Ethanol catabolic process	IDA	23207770
GO:0006584	Process	Catecholamine metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	IDA	20056724, 20417180
GO:0008146	Function	Sulfotransferase activity	IEA
GO:0008146	Function	Sulfotransferase activity	TAS	9119390
GO:0008202	Process	Steroid metabolic process	IEA
GO:0009309	Process	Amine biosynthetic process	TAS	9119390
GO:0016740	Function	Transferase activity	IEA
GO:0018958	Process	Phenol-containing compound metabolic process	IDA	20417180
GO:0047894	Function	Flavonol 3-sulfotransferase activity	IDA	20056724
GO:0050427	Process	3'-phosphoadenosine 5'-phosphosulfate metabolic process	IDA	23207770
GO:0051923	Process	Sulfation	IBA
GO:0051923	Process	Sulfation	IDA	20056724, 23207770

Other IDs

• MIM: 601292
• HGNC: 11454
• e!Ensembl: ENSG00000197165

Protein

• UniProt ID: P50226
• Protein name: Sulfotransferase 1A2 (ST1A2) (EC 2.8.2.1) (Aryl sulfotransferase 2) (Phenol sulfotransferase 2) (Phenol-sulfating phenol sulfotransferase 2) (P-PST 2)
• Protein function: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. Is also responsible for the sulfonation and activation of minoxi
• PDB: 1Z29
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00685	Sulfotransfer_1	38 → 288	Sulfotransferase domain	Domain

• Sequence:

  MELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDM
  IYQGGDLEKCHRAPIFMRVPFLEFKVPGIPSGMETLKNTPAPRLLKTHLPLALLPQTLLD
  QKVKVVYVARNAKDVAVSYYHFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWW
  ELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNY
  TTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAKKMAGCSLSFRSEL

• Sequence length: 295

Pathways

KEGG:

Chemical carcinogenesis - DNA adducts

Reactome:

Cytosolic sulfonation of small molecules

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Breast Neoplasms	Associate	23922954, 36077333	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	28099906	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Inhibit	35872023	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Associate	33601420	★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Neoplasms	Associate	25811737	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Associate	37142702	★☆☆☆☆ Found in Text Mining only
Obesity	Associate	26449484, 37142702	★☆☆☆☆ Found in Text Mining only
Overweight	Associate	37142702	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	28099906	★☆☆☆☆ Found in Text Mining only