Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6795
Gene name Gene Name - the full gene name approved by the HGNC.	Aurora kinase C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	AURKC
Synonyms (NCBI Gene) Gene synonyms aliases	AIE2, AIK3, ARK3, AurC, HEL-S-90, SPGF5, STK13, aurora-C
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.43
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the Aurora subfamily of serine/threonine protein kinases. The encoded protein is a chromosomal passenger protein that forms complexes with Aurora-B and inner centromere proteins and may play a role in organizing microtubules

Show/Hide all(4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs74179426	->C	Conflicting-interpretations-of-pathogenicity	5 prime UTR variant, non coding transcript variant, intron variant
rs121908654	G>A	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs397515484	A>G	Pathogenic	Splice acceptor variant
rs397515619	C>-	Pathogenic	Frameshift variant, coding sequence variant, non coding transcript variant

Show/Hide all(12)

miRTarBase ID	miRNA	Experiments
MIRT812205	hsa-miR-125a-5p	CLIP-seq
MIRT812206	hsa-miR-125b	CLIP-seq
MIRT812207	hsa-miR-4319	CLIP-seq
MIRT812208	hsa-miR-4732-3p	CLIP-seq
MIRT812209	hsa-miR-4768-3p	CLIP-seq
MIRT812210	hsa-miR-665	CLIP-seq
MIRT812211	hsa-miR-670	CLIP-seq
MIRT812205	hsa-miR-125a-5p	CLIP-seq
MIRT812206	hsa-miR-125b	CLIP-seq
MIRT812207	hsa-miR-4319	CLIP-seq
MIRT812208	hsa-miR-4732-3p	CLIP-seq
MIRT812211	hsa-miR-670	CLIP-seq

Show/Hide all(38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IBA
GO:0000793	Component	Condensed chromosome	IDA	15670791
GO:0000922	Component	Spindle pole	IBA
GO:0004672	Function	Protein kinase activity	IDA	15670791
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004712	Function	Protein serine/threonine/tyrosine kinase activity	TAS	19774610
GO:0005515	Function	Protein binding	IPI	21988832, 27332895, 32296183, 32707033, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005819	Component	Spindle	IEA
GO:0005819	Component	Spindle	TAS	19774610
GO:0005856	Component	Cytoskeleton	IEA
GO:0005876	Component	Spindle microtubule	IBA
GO:0006468	Process	Protein phosphorylation	IDA	15670791
GO:0007052	Process	Mitotic spindle organization	IBA
GO:0008608	Process	Attachment of spindle microtubules to kinetochore	TAS	19774610
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030496	Component	Midbody	IBA
GO:0030496	Component	Midbody	IDA	15670791
GO:0030496	Component	Midbody	TAS	19774610
GO:0032133	Component	Chromosome passenger complex	IBA
GO:0032133	Component	Chromosome passenger complex	TAS	19774610
GO:0032465	Process	Regulation of cytokinesis	IBA
GO:0032467	Process	Positive regulation of cytokinesis	TAS	19774610
GO:0051233	Component	Spindle midzone	IBA
GO:0051233	Component	Spindle midzone	IDA	15670791
GO:0051256	Process	Mitotic spindle midzone assembly	TAS	19774610
GO:0051301	Process	Cell division	IEA
GO:0051321	Process	Meiotic cell cycle	IEA
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
603495	11391	ENSG00000105146

Protein

UniProt ID

Q9UQB9

Protein name

Aurora kinase C (EC 2.7.11.1) (Aurora 3) (Aurora/IPL1-related kinase 3) (ARK-3) (Aurora-related kinase 3) (Aurora/IPL1/Eg2 protein 2) (Serine/threonine-protein kinase 13) (Serine/threonine-protein kinase aurora-C)

Protein function

Serine/threonine-protein kinase component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segre

PDB

6GR8 , 6GR9 , 9ESA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	43 → 293	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 and isoform 2 are expressed in testis. Elevated expression levels were seen only in a subset of cancer cell lines such as Hep-G2, Huh-7 and HeLa. Expression is maximum at M phase. {ECO:0000269|PubMed:15670791}.

Sequence

MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLA
RLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLIL
EYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEV
KIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFE
SASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRV
LPPCAQMAS

Sequence length

309

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
infertility associated with multi-tailed spermatozoa and excessive dna	Infertility associated with multi-tailed spermatozoa and excessive DNA	rs397515484, rs397515619, rs121908654	N/A

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
spermatogenic failure	Spermatogenic Failure	N/A	N/A	ClinVar
Spermatogenic Failure	spermatogenic failure 5	N/A	N/A	GenCC

Show/Hide Text Mining Associations (15)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Breast Neoplasms	Associate	25994570
Carcinogenesis	Associate	25990457
Fetal Growth Retardation	Inhibit	32452402
Glioblastoma	Associate	34465813
Infertility	Associate	25219909, 26341096
Infertility Male	Associate	24484996, 25219909, 30594972
Klinefelter Syndrome	Associate	25219909
Male Infertility with Large Headed Multiflagellar Polyploid Spermatozoa	Associate	24484996
Megalencephaly	Associate	23273756, 25755131
Neoplasms	Associate	10066797, 21762492, 22283874, 24603334, 25990457, 25994570
Prostatic Neoplasms	Associate	23075505
Renal Insufficiency	Associate	31530649
Stomach Neoplasms	Associate	27270838, 31521144
Teratozoospermia	Associate	25219909
Wilms Tumor	Associate	28930610

AURKC (aurora kinase C)