Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6783
Gene name Gene Name - the full gene name approved by the HGNC.	Sulfotransferase family 1E member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SULT1E1
Synonyms (NCBI Gene) Gene synonyms aliases	EST, EST-1, ST1E1, STE
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4q13.3
Summary Summary of gene provided in NCBI Entrez Gene.	Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and

Show/Hide all(89)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007036	hsa-miR-199a-5p	Luciferase reporter assay	23060436
MIRT022279	hsa-miR-124-3p	Microarray	18668037
MIRT1402883	hsa-miR-3120-5p	CLIP-seq
MIRT1402884	hsa-miR-3125	CLIP-seq
MIRT1402885	hsa-miR-3135	CLIP-seq
MIRT1402886	hsa-miR-3173-3p	CLIP-seq
MIRT1402887	hsa-miR-3185	CLIP-seq
MIRT1402888	hsa-miR-3664-5p	CLIP-seq
MIRT1402889	hsa-miR-3672	CLIP-seq
MIRT1402890	hsa-miR-3916	CLIP-seq
MIRT1402891	hsa-miR-3922-5p	CLIP-seq
MIRT1402892	hsa-miR-4282	CLIP-seq
MIRT1402893	hsa-miR-4522	CLIP-seq
MIRT1402894	hsa-miR-4797-5p	CLIP-seq
MIRT1402895	hsa-miR-548p	CLIP-seq
MIRT1402896	hsa-miR-570	CLIP-seq
MIRT1402897	hsa-miR-627	CLIP-seq
MIRT1402898	hsa-miR-759	CLIP-seq
MIRT2120770	hsa-miR-1227	CLIP-seq
MIRT2120771	hsa-miR-219-5p	CLIP-seq
MIRT2120772	hsa-miR-3122	CLIP-seq
MIRT1402885	hsa-miR-3135	CLIP-seq
MIRT2120773	hsa-miR-3689a-3p	CLIP-seq
MIRT2120774	hsa-miR-3689c	CLIP-seq
MIRT2120775	hsa-miR-3909	CLIP-seq
MIRT2120776	hsa-miR-3913-5p	CLIP-seq
MIRT2120777	hsa-miR-4252	CLIP-seq
MIRT2120778	hsa-miR-4445	CLIP-seq
MIRT2120779	hsa-miR-4691-5p	CLIP-seq
MIRT2120780	hsa-miR-4728-5p	CLIP-seq
MIRT2120781	hsa-miR-4782-3p	CLIP-seq
MIRT1402894	hsa-miR-4797-5p	CLIP-seq
MIRT2120782	hsa-miR-508-3p	CLIP-seq
MIRT1402898	hsa-miR-759	CLIP-seq
MIRT2120783	hsa-miR-766	CLIP-seq
MIRT2342797	hsa-miR-1225-3p	CLIP-seq
MIRT2120770	hsa-miR-1227	CLIP-seq
MIRT2342798	hsa-miR-1233	CLIP-seq
MIRT2342799	hsa-miR-1273f	CLIP-seq
MIRT2342800	hsa-miR-143	CLIP-seq
MIRT2120771	hsa-miR-219-5p	CLIP-seq
MIRT2342801	hsa-miR-2467-5p	CLIP-seq
MIRT2120772	hsa-miR-3122	CLIP-seq
MIRT2342802	hsa-miR-3612	CLIP-seq
MIRT2120773	hsa-miR-3689a-3p	CLIP-seq
MIRT2120774	hsa-miR-3689c	CLIP-seq
MIRT2120776	hsa-miR-3913-5p	CLIP-seq
MIRT1402891	hsa-miR-3922-5p	CLIP-seq
MIRT2342803	hsa-miR-3929	CLIP-seq
MIRT2120777	hsa-miR-4252	CLIP-seq
MIRT2342804	hsa-miR-4419b	CLIP-seq
MIRT2342805	hsa-miR-4443	CLIP-seq
MIRT2120778	hsa-miR-4445	CLIP-seq
MIRT2342806	hsa-miR-4478	CLIP-seq
MIRT2342807	hsa-miR-4708-5p	CLIP-seq
MIRT2120780	hsa-miR-4728-5p	CLIP-seq
MIRT2342808	hsa-miR-4747-5p	CLIP-seq
MIRT2342809	hsa-miR-4770	CLIP-seq
MIRT2120781	hsa-miR-4782-3p	CLIP-seq
MIRT2342810	hsa-miR-4802-5p	CLIP-seq
MIRT2342811	hsa-miR-485-5p	CLIP-seq
MIRT2120782	hsa-miR-508-3p	CLIP-seq
MIRT2342812	hsa-miR-650	CLIP-seq
MIRT2342813	hsa-miR-890	CLIP-seq
MIRT2120772	hsa-miR-3122	CLIP-seq
MIRT2395423	hsa-miR-3137	CLIP-seq
MIRT2120773	hsa-miR-3689a-3p	CLIP-seq
MIRT2120774	hsa-miR-3689c	CLIP-seq
MIRT2120776	hsa-miR-3913-5p	CLIP-seq
MIRT2395424	hsa-miR-4540	CLIP-seq
MIRT2120780	hsa-miR-4728-5p	CLIP-seq
MIRT2342811	hsa-miR-485-5p	CLIP-seq
MIRT2395425	hsa-miR-654-3p	CLIP-seq
MIRT2342813	hsa-miR-890	CLIP-seq
MIRT2636667	hsa-miR-1283	CLIP-seq
MIRT2120772	hsa-miR-3122	CLIP-seq
MIRT2636668	hsa-miR-3613-3p	CLIP-seq
MIRT2636669	hsa-miR-3667-5p	CLIP-seq
MIRT2636670	hsa-miR-3675-3p	CLIP-seq
MIRT2120773	hsa-miR-3689a-3p	CLIP-seq
MIRT2120774	hsa-miR-3689c	CLIP-seq
MIRT2120776	hsa-miR-3913-5p	CLIP-seq
MIRT2636671	hsa-miR-4684-5p	CLIP-seq
MIRT2120780	hsa-miR-4728-5p	CLIP-seq
MIRT2120772	hsa-miR-3122	CLIP-seq
MIRT2120773	hsa-miR-3689a-3p	CLIP-seq
MIRT2120774	hsa-miR-3689c	CLIP-seq
MIRT2120776	hsa-miR-3913-5p	CLIP-seq
MIRT2120780	hsa-miR-4728-5p	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
TFAP2A	Activation	17187826
TFAP2C	Activation	17187826

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004062	Function	Aryl sulfotransferase activity	IBA	21873635
GO:0004304	Function	Estrone sulfotransferase activity	IEA
GO:0005496	Function	Steroid binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006068	Process	Ethanol catabolic process	IDA	23207770
GO:0006711	Process	Estrogen catabolic process	IDA	23207770
GO:0008146	Function	Sulfotransferase activity	IBA	21873635
GO:0008146	Function	Sulfotransferase activity	IDA	19548878
GO:0008202	Process	Steroid metabolic process	TAS	8185618
GO:0008210	Process	Estrogen metabolic process	IDA	11884392
GO:0031965	Component	Nuclear membrane	IDA
GO:0045600	Process	Positive regulation of fat cell differentiation	IMP	24567372
GO:0047894	Function	Flavonol 3-sulfotransferase activity	IDA	20056724
GO:0050294	Function	Steroid sulfotransferase activity	IDA	11884392, 23207770
GO:0050427	Process	3'-phosphoadenosine 5'-phosphosulfate metabolic process	IDA	23207770
GO:0050427	Process	3'-phosphoadenosine 5'-phosphosulfate metabolic process	TAS
GO:0051923	Process	Sulfation	IBA	21873635
GO:0051923	Process	Sulfation	IDA	19548878, 20056724, 23207770

MIM	HGNC	e!Ensembl
600043	11377	ENSG00000109193

Protein

UniProt ID

P49888

Protein name

Sulfotransferase 1E1 (ST1E1) (EC 2.8.2.4) (EST-1) (Estrogen sulfotransferase) (Sulfotransferase, estrogen-preferring)

Protein function

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of estradiol and estrone (PubMed:11006110, PubMed:11884392, PubMed:7779757). Is a key enzyme in estrogen homeostasis, the

PDB

1G3M , 1HY3 , 4JVL , 4JVM , 4JVN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00685	Sulfotransfer_1	37 → 287	Sulfotransferase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Liver, intestine and at lower level in the kidney.

Sequence

MNSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMI
YKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEK
DCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWE
KGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYT
TLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRTEI

Sequence length

294

Interactions

View interactions

	KEGG		Reactome
	Steroid hormone biosynthesis Metabolic pathways		Cytosolic sulfonation of small molecules

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17013881

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Evidence	Source
Unknown
Uterine Fibroids	Uterine Fibroids		GWAS
Glioblastoma	Glioblastoma	CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587	GWAS, CBGDA

Show/Hide Text Mining Associations (26)

Disease Name	Relationship Type	References
Associations from Text Mining
Atherosclerosis	Associate	14507642
Breast Diseases	Associate	20682005
Breast Neoplasms	Associate	17661084, 19308726, 21720030
Carcinoma Hepatocellular	Associate	28634336
Carcinoma Intraductal Noninfiltrating	Inhibit	17661084, 20682005
Carcinoma Ovarian Epithelial	Associate	25817828
Cerebral Infarction	Associate	23112845
Chronic Periodontitis	Associate	26705104
Colonic Neoplasms	Associate	23370358
Cystic Fibrosis	Associate	18817817
Diabetes Mellitus Type 1	Associate	33083497
Endometrial Neoplasms	Associate	18318428
Endometrial Neoplasms	Inhibit	38412094
Epilepsy	Associate	24824130
Fibrosis	Inhibit	23775849
Inflammation	Inhibit	25817828
Liver Cirrhosis Alcoholic	Inhibit	23775849
Lymphatic Metastasis	Stimulate	23653380
Neoplasms	Associate	14979917, 21720030, 28634336
Obesity	Associate	21543429
Ovarian Neoplasms	Associate	32590918
Pancreatic Neoplasms	Associate	23653380, 30710069
Polycystic Ovary Syndrome	Stimulate	30802529
Prostate cancer familial	Associate	26542807
Tremor	Associate	24824130
Virilism	Associate	32590918

SULT1E1 (sulfotransferase family 1E member 1)