Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6778
Gene name Gene Name - the full gene name approved by the HGNC.	Signal transducer and activator of transcription 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	STAT6
Synonyms (NCBI Gene) Gene synonyms aliases	D12S1644, HIES6, IL-4-STAT, STAT6B, STAT6C
Disease Acronyms (UniProt) Disease acronyms from UniProt database	HIES6
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q13.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that tran

Show/Hide all(128)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017016	hsa-miR-335-5p	Microarray	18185580
MIRT028991	hsa-miR-26b-5p	Microarray	19088304
MIRT052974	hsa-miR-135a-5p	Luciferase reporter assay, qRT-PCR, Western blot	22139076
MIRT437351	hsa-miR-361-5p	Luciferase reporter assay, qRT-PCR, Western blot	24491557
MIRT439116	hsa-miR-10b-5p	3'LIFE	25074381
MIRT439116	hsa-miR-10b-5p	3'LIFE	25074381
MIRT731369	hsa-miR-135b-5p	Luciferase reporter assay	26870245
MIRT731369	hsa-miR-135b-5p	Luciferase reporter assay	26870245
MIRT052974	hsa-miR-135a-5p	Western blot	27293991
MIRT734568	hsa-miR-210-3p	Immunohistochemistry (IHC), qRT-PCR, Flow cytometry	31773789
MIRT052974	hsa-miR-135a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35702088
MIRT756389	hsa-miR-135a-3p	Luciferase reporter assay, qRT-PCR	35980503
MIRT1396063	hsa-miR-1238	CLIP-seq
MIRT1396064	hsa-miR-3176	CLIP-seq
MIRT1396065	hsa-miR-3614-5p	CLIP-seq
MIRT1396066	hsa-miR-3922-3p	CLIP-seq
MIRT1396067	hsa-miR-4280	CLIP-seq
MIRT1396068	hsa-miR-4433	CLIP-seq
MIRT1396069	hsa-miR-4535	CLIP-seq
MIRT1396070	hsa-miR-4691-5p	CLIP-seq
MIRT1396071	hsa-miR-4711-3p	CLIP-seq
MIRT1396072	hsa-miR-4757-5p	CLIP-seq
MIRT1396073	hsa-miR-4776-5p	CLIP-seq
MIRT1396074	hsa-miR-635	CLIP-seq
MIRT1396075	hsa-miR-665	CLIP-seq
MIRT1396076	hsa-miR-711	CLIP-seq
MIRT1396077	hsa-miR-890	CLIP-seq
MIRT1396078	hsa-miR-153	CLIP-seq
MIRT1396079	hsa-miR-4474-5p	CLIP-seq
MIRT1396080	hsa-miR-448	CLIP-seq
MIRT1396081	hsa-miR-450b-5p	CLIP-seq
MIRT1396082	hsa-miR-4643	CLIP-seq
MIRT1396083	hsa-miR-485-3p	CLIP-seq
MIRT1396084	hsa-miR-507	CLIP-seq
MIRT1396085	hsa-miR-557	CLIP-seq
MIRT1396086	hsa-miR-642b	CLIP-seq
MIRT1396063	hsa-miR-1238	CLIP-seq
MIRT2118770	hsa-miR-1912	CLIP-seq
MIRT2118771	hsa-miR-1976	CLIP-seq
MIRT2118772	hsa-miR-198	CLIP-seq
MIRT2118773	hsa-miR-2115	CLIP-seq
MIRT2118774	hsa-miR-2278	CLIP-seq
MIRT2118775	hsa-miR-3130-5p	CLIP-seq
MIRT2118776	hsa-miR-3145-5p	CLIP-seq
MIRT2118777	hsa-miR-3151	CLIP-seq
MIRT2118778	hsa-miR-3160-3p	CLIP-seq
MIRT1396065	hsa-miR-3614-5p	CLIP-seq
MIRT2118779	hsa-miR-370	CLIP-seq
MIRT2118780	hsa-miR-3943	CLIP-seq
MIRT2118781	hsa-miR-411	CLIP-seq
MIRT1396068	hsa-miR-4433	CLIP-seq
MIRT2118782	hsa-miR-4447	CLIP-seq
MIRT2118783	hsa-miR-4472	CLIP-seq
MIRT2118784	hsa-miR-4482	CLIP-seq
MIRT2118785	hsa-miR-4487	CLIP-seq
MIRT2118786	hsa-miR-4494	CLIP-seq
MIRT1396069	hsa-miR-4535	CLIP-seq
MIRT2118787	hsa-miR-4667-3p	CLIP-seq
MIRT2118788	hsa-miR-4690-3p	CLIP-seq
MIRT1396070	hsa-miR-4691-5p	CLIP-seq
MIRT1396071	hsa-miR-4711-3p	CLIP-seq
MIRT1396073	hsa-miR-4776-5p	CLIP-seq
MIRT2118789	hsa-miR-4780	CLIP-seq
MIRT1396083	hsa-miR-485-3p	CLIP-seq
MIRT2118790	hsa-miR-491-5p	CLIP-seq
MIRT2118791	hsa-miR-499a-5p	CLIP-seq
MIRT2118792	hsa-miR-516a-3p	CLIP-seq
MIRT2118793	hsa-miR-558	CLIP-seq
MIRT2118794	hsa-miR-623	CLIP-seq
MIRT1396074	hsa-miR-635	CLIP-seq
MIRT1396075	hsa-miR-665	CLIP-seq
MIRT1396076	hsa-miR-711	CLIP-seq
MIRT2118795	hsa-miR-767-3p	CLIP-seq
MIRT1396077	hsa-miR-890	CLIP-seq
MIRT2634891	hsa-miR-103a	CLIP-seq
MIRT2634892	hsa-miR-107	CLIP-seq
MIRT2634893	hsa-miR-1202	CLIP-seq
MIRT2634894	hsa-miR-1229	CLIP-seq
MIRT2634895	hsa-miR-1277	CLIP-seq
MIRT2634896	hsa-miR-1284	CLIP-seq
MIRT2634897	hsa-miR-149	CLIP-seq
MIRT2634898	hsa-miR-150	CLIP-seq
MIRT2634899	hsa-miR-188-5p	CLIP-seq
MIRT2634900	hsa-miR-18a	CLIP-seq
MIRT2634901	hsa-miR-18b	CLIP-seq
MIRT2634902	hsa-miR-1915	CLIP-seq
MIRT2118771	hsa-miR-1976	CLIP-seq
MIRT2634903	hsa-miR-299-3p	CLIP-seq
MIRT1396064	hsa-miR-3176	CLIP-seq
MIRT2634904	hsa-miR-3189-5p	CLIP-seq
MIRT2634905	hsa-miR-3194-5p	CLIP-seq
MIRT2634906	hsa-miR-3620	CLIP-seq
MIRT2634907	hsa-miR-3689d	CLIP-seq
MIRT2118779	hsa-miR-370	CLIP-seq
MIRT2634908	hsa-miR-3911	CLIP-seq
MIRT1396066	hsa-miR-3922-3p	CLIP-seq
MIRT2118780	hsa-miR-3943	CLIP-seq
MIRT2634909	hsa-miR-3972	CLIP-seq
MIRT2634910	hsa-miR-4266	CLIP-seq
MIRT2634911	hsa-miR-4292	CLIP-seq
MIRT2634912	hsa-miR-4308	CLIP-seq
MIRT2634913	hsa-miR-4310	CLIP-seq
MIRT2634914	hsa-miR-4323	CLIP-seq
MIRT1396068	hsa-miR-4433	CLIP-seq
MIRT2634915	hsa-miR-4443	CLIP-seq
MIRT2634916	hsa-miR-4450	CLIP-seq
MIRT2634917	hsa-miR-4491	CLIP-seq
MIRT2634918	hsa-miR-4514	CLIP-seq
MIRT1396082	hsa-miR-4643	CLIP-seq
MIRT2634919	hsa-miR-4645-5p	CLIP-seq
MIRT2634920	hsa-miR-4657	CLIP-seq
MIRT2118787	hsa-miR-4667-3p	CLIP-seq
MIRT2634921	hsa-miR-4673	CLIP-seq
MIRT2118788	hsa-miR-4690-3p	CLIP-seq
MIRT2634922	hsa-miR-4692	CLIP-seq
MIRT2634923	hsa-miR-4695-5p	CLIP-seq
MIRT2634924	hsa-miR-4726-3p	CLIP-seq
MIRT2634925	hsa-miR-4735-3p	CLIP-seq
MIRT2634926	hsa-miR-4779	CLIP-seq
MIRT2634927	hsa-miR-4786-5p	CLIP-seq
MIRT2118790	hsa-miR-491-5p	CLIP-seq
MIRT2634928	hsa-miR-576-3p	CLIP-seq
MIRT2634929	hsa-miR-599	CLIP-seq
MIRT1396086	hsa-miR-642b	CLIP-seq
MIRT1396075	hsa-miR-665	CLIP-seq
MIRT2118795	hsa-miR-767-3p	CLIP-seq
MIRT2634930	hsa-miR-769-5p	CLIP-seq
MIRT2634931	hsa-miR-891b	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
HDAC9	Repression	21106524
SFPQ	Repression	21106524

Show/Hide all(27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	8810328
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	8810328
GO:0003700	Function	DNA-binding transcription factor activity	TAS	10747856
GO:0005515	Function	Protein binding	IPI	8816495, 9392697, 9651359, 22000020, 23461825
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006952	Process	Defense response	IBA	21873635
GO:0007165	Process	Signal transduction	TAS	10747856
GO:0007259	Process	Receptor signaling pathway via JAK-STAT	IBA	21873635
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA	21873635
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019903	Function	Protein phosphatase binding	IPI	17210636
GO:0032481	Process	Positive regulation of type I interferon production	TAS
GO:0035771	Process	Interleukin-4-mediated signaling pathway	IMP	17210636
GO:0042127	Process	Regulation of cell population proliferation	IBA	21873635
GO:0042802	Function	Identical protein binding	IPI	22000020
GO:0043434	Process	Response to peptide hormone	IBA	21873635
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	8810328
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	IBA	21873635
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	24906148

MIM	HGNC	e!Ensembl
601512	11368	ENSG00000166888

Protein

UniProt ID

P42226

Protein name

Signal transducer and activator of transcription 6 (IL-4 Stat)

Protein function

Carries out a dual function: signal transduction and activation of transcription. Involved in IL4/interleukin-4- and IL3/interleukin-3-mediated signaling.

PDB

1OJ5 , 4Y5U , 4Y5W , 5D39 , 5NWM , 5NWX , 9BIG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02865	STAT_int	2 → 114	STAT protein, protein interaction domain	Domain
PF01017	STAT_alpha	161 → 268	STAT protein, all-alpha domain	Family
PF02864	STAT_bind	277 → 413	STAT protein, DNA binding domain	Domain
PF00017	SH2	537 → 616	SH2 domain	Domain
PF14596	STAT6_C	655 → 847	STAT6 C-terminal	Family

Sequence

MSLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWEFLVGSDAFCCNLASALLSDT
VQHLQASVGEQGEGSTILQHISTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRHLPMP
FHWKQEELKFKTGLRRLQHRVGEIHLLREALQKGAEAGQVSLHSLIETPANGTGPSEALA
MLLQETTGELEAAKALVLKRIQIWKRQQQLAGNGAPFEESLAPLQERCESLVDIYSQLQQ
EVGAAGGELEPKTRASLTGRLDEVLRTLVTSCFLVEKQPPQVLKTQTKFQAGVRFLLGLR
FLGAPAKPPLVRADMVTEKQARELSVPQGPGAGAESTGEIINNTVPLENSIPGNCCSALF
KNLLLKKIKRCERKGTESVTEEKCAVLFSASFTLGPGKLPIQLQALSLPLVVIVHGNQDN
NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQK
IFNDNSLSMEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIG
FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIR
SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPE
LQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSIPPYQGLSPEESVNVLSAFQE
PHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAF
PQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMD
LRANPSW

Sequence length

847

Interactions

View interactions

	KEGG		Reactome
	Necroptosis JAK-STAT signaling pathway Th1 and Th2 cell differentiation Th17 cell differentiation Hepatitis B Pathways in cancer Inflammatory bowel disease		Downstream signal transduction STAT6-mediated induction of chemokines Interleukin-4 and Interleukin-13 signaling

Show/Hide Causal Diseases (6)

Disease term	Disease name	dbSNP ID	References
Causal
Dermatitis	Dermatitis, Atopic	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	15306842
Diffuse lymphoma	Diffuse Large B-Cell Lymphoma	rs121912651, rs121913289, rs121913293, rs878854402, rs869025340, rs1349928568, rs1569115687, rs121913291
Hypophosphatemic rickets	Hypophosphatemic Rickets	rs104894347, rs28937882, rs587776696, rs587776697, rs587776698, rs121908248, rs587776797, rs121908249, rs193922701, rs193922702, rs886041227, rs886041363, rs886041296, rs886041369, rs866429868 View all (6 more)
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	27903959
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582
Pulmonary fibrosis	Pulmonary Fibrosis	rs121918666, rs199422300, rs121917834, rs199422294, rs201159197, rs199422297, rs199422305, rs751381953, rs876661305, rs878853260, rs1555811762, rs1060502990, rs1555903332, rs1554038539, rs1554042899, rs938938578 View all (1 more)	26699812

Show/Hide Unknown Diseases (6)

Disease term	Disease name	References	Source
Unknown
Asthma	Asthma, Childhood asthma	30552067, 31619474, 30929738, 29273806, 30787307, 29785011, 27182965, 31036433	ClinVar, GWAS
Head and neck cancer	Malignant Head and Neck Neoplasm	21765211	ClinVar
Eczema	Eczema		GWAS
Eosinophilia	Eosinophilia		GWAS
Allergic Sensitization	Allergic Sensitization		GWAS
Insomnia	Insomnia		GWAS

Show/Hide Text Mining Associations (161)

Disease Name	Relationship Type	References
Associations from Text Mining
Adamantinoma	Associate	35303277
Adenocarcinoma	Stimulate	30105735
Aggressive Periodontitis	Associate	21198753
Allergic Fungal Sinusitis	Associate	33326802
Anaphylaxis	Associate	36884218, 37316763
Arthritis	Associate	16096332
Arthritis Juvenile	Associate	29928998
Arthritis Rheumatoid	Associate	16096332, 16760256, 17223651, 27629845
Asthma	Associate	15342695, 17532201, 19175798, 20093796, 22162773, 22365404, 22660217, 23402658, 26466682, 32900903, 35140898, 37316763, 39423878, 40375219, 9768594
Asthma	Stimulate	26781462
Astrocytoma	Associate	21595984
Atherosclerosis	Associate	22162773
Autoimmune Diseases	Associate	25407941, 26031516
Axial Spondyloarthritis	Associate	26671920
Breast Neoplasms	Associate	12082548, 23562473, 25104439, 28235236, 28422733, 31075146, 32525891, 32580398, 32883354, 34572592, 35906698, 35999655
Breast Neoplasms	Inhibit	24401087
Burkitt Lymphoma	Associate	20393449, 21828071
Carcinogenesis	Associate	30105735
Carcinoma Ductal	Associate	35906698
Carcinoma Hepatocellular	Stimulate	30105735
Carcinoma Hepatocellular	Associate	31485610, 33006365
Carcinoma Large Cell	Stimulate	30105735
Carcinoma Non Small Cell Lung	Associate	30105735, 40199139
Carcinoma Renal Cell	Associate	20339477, 23935100, 24885059
Carcinoma Renal Cell	Stimulate	32640276
Carcinoma Squamous Cell	Stimulate	28972958, 30105735
Carcinoma Squamous Cell	Associate	39245357
Cholelithiasis	Associate	40536380
Colitis Ulcerative	Associate	20014020, 21308881, 22467146, 23154639, 28752100
Colonic Neoplasms	Associate	20014020
Colorectal Neoplasms	Associate	20480530, 22121102, 27533463, 31075146, 31718693
COVID 19	Associate	35363626
Crohn Disease	Associate	22467146
Cytomegalovirus Infections	Associate	30532138
Demyelinating Diseases	Associate	19398961
Demyelinating Diseases	Stimulate	29596844
Depressive Disorder	Associate	32438399
Dermatitis Atopic	Associate	37316763
Dermatitis Atopic 3	Associate	26781462, 40375219
Dermatomyositis	Associate	27803134
Desmoid disease hereditary	Associate	25873501
Diabetes Mellitus Type 1	Associate	24204704, 30338340
Disease	Associate	15247173, 27803134, 34502329
Drug Hypersensitivity	Associate	16877367, 18154619, 21196282, 23815671, 36884218, 37196636
Eczema	Associate	23815671
Endometrial Neoplasms	Associate	35244291
Eosinophilia	Associate	36884218
Eosinophilic Esophagitis	Inhibit	21694534
Eosinophilic Esophagitis	Associate	23185525, 25407941, 27310888, 30626591, 31490856, 32798708, 35126392
Epstein Barr Virus Infections	Associate	33297669
Fibroma	Associate	32972278
Fibrosis	Associate	27310888
Food Hypersensitivity	Associate	22299310, 29457221, 37316763
Gallbladder Neoplasms	Stimulate	40536380
Gastritis	Inhibit	22524533
Gastrointestinal Diseases	Associate	36884218
Genetic Diseases Inborn	Associate	36884218
Glioblastoma	Associate	21196282, 21595984, 26817999, 33104022
Glioblastoma	Inhibit	31530290
Glioma	Associate	21196282, 31530290
Glioma of Brain Familial	Associate	21196282
Graves Disease	Associate	17362266
Hashimoto Disease	Stimulate	32615729
Head and Neck Neoplasms	Associate	24192080, 35303277
Hemangiopericytoma	Associate	26514459, 26722515, 29700673, 30584643, 30693881, 32843765
Hemangiopericytoma	Stimulate	29600523
Hereditary Breast and Ovarian Cancer Syndrome	Associate	35999655
Hereditary leiomyomatosis and renal cell cancer	Associate	11781246, 18641027, 20876453
Hodgkin Disease	Associate	11781246, 16954503, 17606441, 17652621, 18541724, 21418178, 29449275, 29650799, 31816062, 32079702
Hodgkin Disease	Inhibit	21418178
Hypersensitivity Immediate	Associate	10747856, 15342695, 17362266, 36884218, 37316763
Hypopigmentation	Associate	22992805
Hypoxia	Associate	31530290
Hypoxia Brain	Associate	31530290
Ige Responsiveness Atopic	Associate	19592641
Infections	Stimulate	32418990
Inflammation	Associate	10982806, 18209728, 18494930, 19175798, 23402658, 23815671, 26031516, 26243279, 26466682, 26781462, 27808402, 28752100, 30105735, 31490856, 36884218 View all (5 more)
Inflammatory Bowel Disease 2	Associate	12605697
Inflammatory Bowel Diseases	Associate	12605697, 19230040
Inflammatory Breast Neoplasms	Associate	29485045
Intestinal Diseases	Associate	19520737
Job Syndrome	Associate	19175798, 9768594
Leprosy	Associate	30642265
Leukemia	Associate	20438785
Leukemia B Cell	Associate	15591113, 17210636
Leukemia Biphenotypic Acute	Associate	25193702
Leukemia Lymphocytic Chronic B Cell	Associate	23072591, 24966942
Leukemia Lymphoma Adult T Cell	Associate	9391124
Leukemia Myeloid Acute	Associate	23474756
Leukemia T Cell	Associate	24223100
Liposarcoma	Associate	24457460, 40540926
Liposarcoma Myxoid	Associate	40540926
Liver Failure	Associate	40536380
Lung Injury	Associate	31679431
Lung Neoplasms	Associate	22162773
Lupus Erythematosus Systemic	Associate	33763079
Lymphatic Metastasis	Associate	20480530
Lymphoma	Associate	16418334, 21418178, 25428220, 26246572, 31075146, 37316763
Lymphoma B Cell	Associate	15044251, 19423726, 23852366, 31816062, 32555149, 33945543, 40030008, 40243506, 9584180
Lymphoma Follicular	Associate	18682601, 20944673, 23297127, 25428220, 29193015, 32555149, 33211828, 34957565, 35363872, 35816682, 35851155, 37316763, 37493986, 37561599
Lymphoma Large B Cell Diffuse	Associate	17210636, 33684939, 37032379
Lymphoma Large B Cell Diffuse	Inhibit	32600091
Lymphoma Non Hodgkin	Inhibit	11781246
Lymphoma Non Hodgkin	Associate	26965583, 32555149
Lymphoma T Cell Cutaneous	Associate	25485578, 25486484, 32438399
Malignant mesenchymal tumor	Associate	33986460
Malignant Teratocarcinosarcoma	Associate	35303277
Meningioma	Associate	23860521
Metaplasia	Associate	34822557
Migraine Disorders	Associate	37592229
Mitochondrial Diseases	Associate	35718799
Multiple Myeloma	Associate	31568628
Multiple Sclerosis	Associate	18209728, 19398961
Mycosis Fungoides	Associate	32438399
Myotonic Disorders	Stimulate	33386815
Nasal Polyps	Associate	37385124
Neoplasm Metastasis	Associate	20480530, 26208975, 29309807, 34502329
Neoplasms	Associate	16418334, 20339477, 22067385, 23297127, 23313954, 25873501, 26246572, 26253700, 26686340, 26817999, 27255164, 27562490, 28494796, 29650799, 29700673 View all (22 more)
Nephrotic Syndrome	Associate	22252769
Neuraminidase 1 deficiency	Associate	21860904
Neuroendocrine Tumors	Associate	36307579
Neuroinflammatory Diseases	Associate	16877367
Neuromuscular Junction Diseases	Associate	37734479
Osteoarthritis	Associate	28064224
Ovarian Neoplasms	Associate	28536310
Pain	Associate	33848569
Pancreatic Neoplasms	Associate	36335356
Pemphigus	Associate	32926429
Plasmablastic Lymphoma	Associate	33297669
Pleuropulmonary blastoma	Associate	25432794
Polyradiculoneuropathy Chronic Inflammatory Demyelinating	Associate	18209728, 19398961
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	20438785, 29656114
Prodromal Symptoms	Associate	35816682
Prostate cancer familial	Associate	30183767, 30693881
Prostatic Neoplasms	Associate	20025723, 38087324
Pulmonary Disease Chronic Obstructive	Associate	31679431
Pulmonary Fibrosis	Associate	35964659
Rectal Neoplasms	Associate	22121102
Retinal Dysplasia	Associate	22021169
Sarcoma	Associate	35238118
Sarcoma Kaposi	Associate	28099521
Sertoli Cell Only Syndrome	Associate	15591113
Sezary Syndrome	Stimulate	32438399
Sjogren's Syndrome	Associate	26031516
Skin Diseases	Associate	16877367, 22992805
Soft Tissue Neoplasms	Associate	37905637
Solitary Fibrous Tumors	Associate	23313952, 23313954, 23860521, 24030747, 24434011, 24457460, 25432794, 25873501, 26022454, 26226844, 26337721, 26617768, 26686340, 26722515, 26817999 View all (23 more)
Solitary Fibrous Tumors	Stimulate	29600523
Squamous Cell Carcinoma of Head and Neck	Associate	24192080
Status Asthmaticus	Associate	25848896, 26243279, 40375219
Stomach Neoplasms	Associate	30944204
Tertiary Lymphoid Structures	Associate	40536380
Thyroid Cancer Papillary	Associate	32615729
Triple Negative Breast Neoplasms	Associate	37561599
Tuberculosis	Associate	17921069
Tuberculosis Multidrug Resistant	Associate	37196636
Urogenital Neoplasms	Associate	27802414
Uterine Cervical Neoplasms	Associate	25127987
Virus Diseases	Associate	28099521
Vitiligo	Associate	28129744
X Linked Combined Immunodeficiency Diseases	Associate	9054429

STAT6 (signal transducer and activator of transcription 6)