Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6774
Gene name	Signal transducer and activator of transcription 3
Gene symbol	STAT3
Synonyms (NCBI Gene)	ADMIOADMIO1APRFHIES
Chromosome	17
Chromosome location	17q21.2
Summary	The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the ce

Show/Hide all (56)

SNP ID	Visualize variation	Clinical significance	Consequence
rs113994135	G>A	Pathogenic	Coding sequence variant, missense variant
rs113994136	C>A,T	Pathogenic	Coding sequence variant, missense variant
rs113994137	C>T	Pathogenic	Coding sequence variant, missense variant
rs113994138	CAC>-	Pathogenic	Coding sequence variant, inframe deletion
rs113994139	C>T	Pathogenic	Coding sequence variant, missense variant
rs193922716	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs193922717	C>T	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs193922719	T>A	Likely-pathogenic	Missense variant, coding sequence variant
rs193922720	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs193922721	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs193922722	A>G	Likely-pathogenic	Missense variant, coding sequence variant
rs397514766	G>A	Pathogenic	Coding sequence variant, missense variant
rs574370336	G>C	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs587777648	T>C	Pathogenic	Coding sequence variant, missense variant
rs587777649	G>A,C	Pathogenic	Coding sequence variant, missense variant, synonymous variant
rs587777650	C>G	Pathogenic	Coding sequence variant, missense variant
rs769031989	T>A	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs786205503	C>A	Likely-pathogenic	Missense variant, coding sequence variant
rs869312887	C>G	Pathogenic	Missense variant, coding sequence variant
rs869312888	C>T	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs869312889	G>A	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs869312890	G>A	Pathogenic	Missense variant, coding sequence variant
rs869312891	C>A	Pathogenic	Missense variant, coding sequence variant
rs869312892	G>A	Pathogenic	Missense variant, coding sequence variant, intron variant
rs869312893	A>C	Pathogenic	Missense variant, coding sequence variant
rs869312894	C>T	Pathogenic	Missense variant, coding sequence variant
rs886039434	A>G	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs886039546	T>C	Pathogenic	Missense variant, coding sequence variant
rs1057520377	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1057521091	T>C,G	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs1064793452	CCGT>-	Pathogenic	Frameshift variant, coding sequence variant
rs1064794421	ATA>CTG	Likely-pathogenic	Coding sequence variant, missense variant
rs1064794899	C>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1064794957	G>A,C	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs1064796762	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1064796922	A>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1085307931	A>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1131691377	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs1131691476	A>G	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs1131691937	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1555562364	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1555563717	A>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1555563854	G>C,T	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs1555563871	C>T	Pathogenic	Coding sequence variant, missense variant
rs1555565595	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1555566820	A>C,T	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs1555568535	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1567708034	G>A	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs1567713850	T>A	Pathogenic	Coding sequence variant, missense variant
rs1598381121	A>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1598381169	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1598393453	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1598399795	G>T	Pathogenic	Missense variant, coding sequence variant
rs1598406623	C>A	Pathogenic	Splice donor variant
rs1598406651	C>T	Likely-pathogenic	Splice acceptor variant
rs1598423756	C>T	Likely-pathogenic	Splice acceptor variant

891

Show/Hide all (891)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000497	hsa-miR-20b-5p	qRT-PCRELISAChIPWestern blot	20232316
MIRT005006	hsa-miR-125b-5p	Microarray	17891175
MIRT006959	hsa-miR-337-3p	Luciferase reporter assayqRT-PCRWestern blot	22723956
MIRT021003	hsa-miR-155-5p	Proteomics	18668040
MIRT028178	hsa-miR-93-5p	Sequencing	20371350
MIRT031079	hsa-miR-21-5p	Western blot;Other	20048743
MIRT031079	hsa-miR-21-5p	Microarray	18591254
MIRT051593	hsa-let-7e-5p	CLASH	23622248
MIRT050559	hsa-miR-20a-5p	CLASH	23622248
MIRT049359	hsa-miR-92a-3p	CLASH	23622248
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	24287565
MIRT052931	hsa-miR-124-3p	ImmunofluorescenceImmunohistochemistryLuciferase reporter assayWestern blot	24211205
MIRT053071	hsa-miR-130b-3p	Luciferase reporter assayqRT-PCRWestern blot	24040078
MIRT050559	hsa-miR-20a-5p	qRT-PCRWestern blot	23836497
MIRT053229	hsa-miR-106a-5p	qRT-PCRWestern blot	23836497
MIRT049359	hsa-miR-92a-3p	H358"	23820254
MIRT054144	hsa-miR-106b-5p	Luciferase reporter assayqRT-PCRWestern blot	25307786
MIRT054144	hsa-miR-106b-5p	Luciferase reporter assayqRT-PCRWestern blot	25307786
MIRT054273	hsa-miR-874-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	25596740
MIRT054273	hsa-miR-874-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	25596740
MIRT054631	hsa-miR-4516	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	24610393
MIRT054631	hsa-miR-4516	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	24610393
MIRT054903	hsa-miR-17-5p	ImmunoblotLuciferase reporter assay	25594054
MIRT053229	hsa-miR-106a-5p	Luciferase reporter assay	23399684
MIRT438928	hsa-miR-1181	FlowImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	25444909
MIRT438928	hsa-miR-1181	FlowImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	25444909
MIRT031079	hsa-miR-21-5p	ELISAqRT-PCRWestern blot	23998932
MIRT438669	hsa-miR-1234-3p	MicroarrayqRT-PCRWestern blot	23841503
MIRT052931	hsa-miR-124-3p	ELISAImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23856509
MIRT052931	hsa-miR-124-3p	ELISAImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23856509
MIRT054903	hsa-miR-17-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot	23059786
MIRT050559	hsa-miR-20a-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot	23059786
MIRT438217	hsa-miR-181a-5p	qRT-PCRWestern blot	24329418
MIRT052931	hsa-miR-124-3p	Luciferase reporter assay	24184980
MIRT052931	hsa-miR-124-3p	Luciferase reporter assay	24184980
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRimmunostainingWestern blotting	23940556
MIRT438928	hsa-miR-1181	FlowImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	25444909
MIRT438928	hsa-miR-1181	FlowImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	25444909
MIRT031079	hsa-miR-21-5p	ELISAqRT-PCRWestern blot	23998932
MIRT438669	hsa-miR-1234-3p	MicroarrayqRT-PCRWestern blot	23841503
MIRT052931	hsa-miR-124-3p	ELISAImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23856509
MIRT052931	hsa-miR-124-3p	ELISAImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23856509
MIRT054903	hsa-miR-17-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot	23059786
MIRT050559	hsa-miR-20a-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot	23059786
MIRT438217	hsa-miR-181a-5p	qRT-PCRWestern blot	24329418
MIRT052931	hsa-miR-124-3p	Luciferase reporter assay	24184980
MIRT052931	hsa-miR-124-3p	Luciferase reporter assay	24184980
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRimmunostainingWestern blotting	23940556
MIRT679681	hsa-miR-4438	HITS-CLIP	23824327
MIRT679680	hsa-miR-500b-3p	HITS-CLIP	23824327
MIRT679679	hsa-miR-6789-3p	HITS-CLIP	23824327
MIRT679678	hsa-miR-3199	HITS-CLIP	23824327
MIRT679677	hsa-miR-8052	HITS-CLIP	23824327
MIRT679676	hsa-miR-365a-5p	HITS-CLIP	23824327
MIRT679675	hsa-miR-365b-5p	HITS-CLIP	23824327
MIRT679674	hsa-miR-5095	HITS-CLIP	23824327
MIRT679673	hsa-miR-7151-3p	HITS-CLIP	23824327
MIRT666067	hsa-miR-6872-3p	HITS-CLIP	23824327
MIRT666066	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT666064	hsa-miR-4720-3p	HITS-CLIP	23824327
MIRT666065	hsa-miR-6762-3p	HITS-CLIP	23824327
MIRT666063	hsa-miR-6807-5p	HITS-CLIP	23824327
MIRT642430	hsa-miR-618	HITS-CLIP	23824327
MIRT642429	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT642428	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT642427	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT642426	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT642425	hsa-miR-5581-3p	HITS-CLIP	23824327
MIRT642424	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT492170	hsa-miR-548n	PAR-CLIP	23592263
MIRT492169	hsa-miR-371b-3p	PAR-CLIP	23592263
MIRT492168	hsa-miR-138-2-3p	PAR-CLIP	23592263
MIRT492166	hsa-miR-7158-5p	PAR-CLIP	23592263
MIRT492167	hsa-miR-4684-5p	PAR-CLIP	23592263
MIRT492165	hsa-miR-1178-3p	PAR-CLIP	23592263
MIRT492164	hsa-miR-4768-5p	PAR-CLIP	23592263
MIRT492163	hsa-miR-6833-3p	PAR-CLIP	23592263
MIRT492162	hsa-miR-6809-3p	PAR-CLIP	23592263
MIRT466961	hsa-miR-6871-3p	PAR-CLIP	23592263
MIRT466959	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT466960	hsa-miR-1288-5p	PAR-CLIP	23592263
MIRT466958	hsa-miR-922	PAR-CLIP	23592263
MIRT466956	hsa-miR-4270	PAR-CLIP	23592263
MIRT466957	hsa-miR-4441	PAR-CLIP	23592263
MIRT466955	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT466954	hsa-miR-7113-5p	PAR-CLIP	23592263
MIRT466953	hsa-miR-4685-5p	PAR-CLIP	23592263
MIRT466952	hsa-miR-6837-5p	PAR-CLIP	23592263
MIRT466951	hsa-miR-5681a	PAR-CLIP	23592263
MIRT466950	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT054144	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT050559	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT054144	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT054903	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT000497	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT028178	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT726433	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT050559	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT726433	hsa-miR-519d-3p	Luciferase reporter assayqRT-PCRWestern blot	26238950
MIRT731450	hsa-miR-520c-3p	Luciferase reporter assayqRT-PCRWestern blot	28112380
MIRT731450	hsa-miR-520c-3p	Luciferase reporter assayqRT-PCRWestern blot	28112380
MIRT005006	hsa-miR-125b-5p	Western blot	28108732
MIRT052931	hsa-miR-124-3p	Luciferase reporter assay	26993295
MIRT731625	hsa-miR-125a-5p	ImmunoblotLuciferase reporter assayqRT-PCR	26389681
MIRT731625	hsa-miR-125a-5p	ImmunoblotLuciferase reporter assayqRT-PCR	26389681
MIRT145857	hsa-miR-200a-3p	qRT-PCR	26535690
MIRT052931	hsa-miR-124-3p	FlowqRT-PCRWestern blot	26109806
MIRT052931	hsa-miR-124-3p	Luciferase reporter assay	26707908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assay	26707908
MIRT731935	hsa-miR-21-3p	Luciferase reporter assayqRT-PCRWestern blot	27895788
MIRT731935	hsa-miR-21-3p	Luciferase reporter assayqRT-PCRWestern blot	27895788
MIRT054144	hsa-miR-106b-5p	FlowLuciferase reporter assayqRT-PCRWestern blot	26956882
MIRT054144	hsa-miR-106b-5p	FlowLuciferase reporter assayqRT-PCRWestern blot	26956882
MIRT054144	hsa-miR-106b-5p	FlowLuciferase reporter assayqRT-PCRWestern blot	26956882
MIRT054144	hsa-miR-106b-5p	FlowLuciferase reporter assayqRT-PCRWestern blot	26956882
MIRT054144	hsa-miR-106b-5p	FlowLuciferase reporter assayqRT-PCRWestern blot	26956882
MIRT054144	hsa-miR-106b-5p	FlowLuciferase reporter assayqRT-PCRWestern blot	26956882
MIRT732189	hsa-miR-519a-3p	Luciferase reporter assayqRT-PCRWestern blot	26970980
MIRT732189	hsa-miR-519a-3p	Luciferase reporter assayqRT-PCRWestern blot	26970980
MIRT053229	hsa-miR-106a-5p	Luciferase reporter assayqRT-PCRWestern blot	27325313
MIRT053229	hsa-miR-106a-5p	Luciferase reporter assayqRT-PCRWestern blot	27325313
MIRT054144	hsa-miR-106b-5p	Luciferase reporter assayqRT-PCRWestern blot	27325313
MIRT054144	hsa-miR-106b-5p	Luciferase reporter assayqRT-PCRWestern blot	27325313
MIRT732362	hsa-miR-148a-3p	Luciferase reporter assayqRT-PCRWestern blot	28280370
MIRT732362	hsa-miR-148a-3p	Luciferase reporter assayqRT-PCRWestern blot	28280370
MIRT386936	hsa-miR-544a	Luciferase reporter assayqRT-PCRWestern blot	27186677
MIRT386936	hsa-miR-544a	Luciferase reporter assayqRT-PCRWestern blot	27186677
MIRT053071	hsa-miR-130b-3p	qRT-PCRWestern blot	26475357
MIRT052931	hsa-miR-124-3p	ELISAFlowqRT-PCRWestern blot	27824145
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT031079	hsa-miR-21-5p	Western blot	26549725
MIRT031079	hsa-miR-21-5p	Western blot	26549725
MIRT755943	hsa-miR-323a-3p	qRT-PCR	27059796
MIRT731625	hsa-miR-125a-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCR	26389681
MIRT735260	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCRWestern blot	26175849
MIRT735260	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCRWestern blot	26175849
MIRT005006	hsa-miR-125b-5p	5.0	27576314
MIRT005006	hsa-miR-125b-5p	5.0	27576314
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25928665
MIRT735332	hsa-miR-340-5p	Luciferase reporter assayqRT-PCRWestern blot	28413603
MIRT735332	hsa-miR-340-5p	Luciferase reporter assayqRT-PCRWestern blot	28413603
MIRT735332	hsa-miR-340-5p	Luciferase reporter assayqRT-PCRWestern blot	28413603
MIRT735332	hsa-miR-340-5p	Luciferase reporter assayqRT-PCRWestern blot	28413603
MIRT732447	hsa-miR-1301-3p	Luciferase reporter assayWestern blotting	33984882
MIRT053229	hsa-miR-106a-3p	RNA-seq	33037409
MIRT053229	hsa-miR-106a-3p	RNA-seq	33037409
MIRT053229	hsa-miR-106a-3p	RNA-seq	33037409
MIRT732763	hsa-miR-19b-3p	Western blotting	33490119
MIRT732900	hsa-miR-140-3p	Luciferase reporter assayWestern blotting	33456538
MIRT733039	hsa-miR-30b-3p	Immunoprecipitaion (IP)qRT-PCRWestern blotting	33408780
MIRT733101	hsa-miR-135b-5p	ImmunofluorescenceImmunohistochemistry (IHC)In situ hybridizationLuciferase reporter assayqRT-PCRWestern blotting	33990540
MIRT733109	hsa-miR-532-5p	Luciferase reporter assayWestern blottingqRT-PCR	33209030
MIRT733220	hsa-miR-590-5p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)qRT-PCR	31520555
MIRT733681	hsa-miR-301b-3p	Luciferase reporter assayqRT-PCRWestern blotting	32170715
MIRT006959	hsa-miR-337-3p	Luciferase reporter assayqRT-PCRWestern blotting	33896365
MIRT734531	hsa-miR-296-5p	qRT-PCRWestern blotting	33664565
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)qRT-PCRFlow cytometry	32236565
MIRT734695	hsa-miR-298	qRT-PCR	31484947
MIRT734774	hsa-miR-130a-3p	Western blottingRNA-seqqRT-PCRFlow cytometryImmunocytochemistry (ICC)	33614244
MIRT005006	hsa-miR-125b-5p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)ImmunofluorescenceqRT-PCR	32982449
MIRT054903	hsa-miR-17-5p	Luciferase reporter assayWestern blottingMicroarrayImmunohistochemistry (IHC)RNA-seqqRT-PCR	32683798
MIRT052931	hsa-miR-124-3p	Western blottingImmunohistochemistry (IHC)	32850781
MIRT735260	hsa-miR-29b-3p	Luciferase reporter assayWestern blottingqRT-PCR	32653922
MIRT735330	hsa-miR-199a-3p	Luciferase reporter assayWestern blottingImmunofluorescenceqRT-PCR	32354746
MIRT735332	hsa-miR-340-5p	Luciferase reporter assayWestern blottingqRT-PCR	32706318
MIRT054903	hsa-miR-17-5p	Luciferase reporter assayWestern blottingqRT-PCR	32095982
MIRT735654	hsa-miR-143-3p	Western blottingMicroarrayqRT-PCR	31441360
MIRT735753	hsa-miR-204-5p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)ImmunofluorescenceqRT-PCR	31938073
MIRT735773	hsa-miR-4500	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)qRT-PCR	31788846
MIRT737197	hsa-miR-634	Luciferase reporter assayWestern blottingqRT-PCRFlow cytometry	32077744
MIRT737204	hsa-miR-551b-3p	Luciferase reporter assayWestern blottingNorthern blottingImmunoprecipitaion (IP)Immunohistochemistry (IHC)qRT-PCRIn situ hybridizationFlow cytometryELISA	31875548
MIRT737370	hsa-miR-296-3p	Western blottingMicroarrayRNA-seqqRT-PCR	32326395
MIRT735260	hsa-miR-29b-3p	Luciferase reporter assayWestern blottingqRT-PCR	32653922
MIRT735753	hsa-miR-204-5p	Western blottingImmunohistochemistry (IHC)qRT-PCRIn situ hybridizationELISA	32487559
MIRT737511	hsa-miR-29b-2-5p	Western blottingqRT-PCR	33929970
MIRT737511	hsa-miR-29b-2-5p	Western blottingRNA-seqqRT-PCR	31561125
MIRT679681	hsa-miR-4438	HITS-CLIP	23824327
MIRT679680	hsa-miR-500b-3p	HITS-CLIP	23824327
MIRT679679	hsa-miR-6789-3p	HITS-CLIP	23824327
MIRT679678	hsa-miR-3199	HITS-CLIP	23824327
MIRT679677	hsa-miR-8052	HITS-CLIP	23824327
MIRT679676	hsa-miR-365a-5p	HITS-CLIP	23824327
MIRT679675	hsa-miR-365b-5p	HITS-CLIP	23824327
MIRT679674	hsa-miR-5095	HITS-CLIP	23824327
MIRT679673	hsa-miR-7151-3p	HITS-CLIP	23824327
MIRT666067	hsa-miR-6872-3p	HITS-CLIP	23824327
MIRT666066	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT666064	hsa-miR-4720-3p	HITS-CLIP	23824327
MIRT666065	hsa-miR-6762-3p	HITS-CLIP	23824327
MIRT666063	hsa-miR-6807-5p	HITS-CLIP	23824327
MIRT642430	hsa-miR-618	HITS-CLIP	23824327
MIRT642429	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT642428	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT642427	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT642426	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT642425	hsa-miR-5581-3p	HITS-CLIP	23824327
MIRT642424	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT492170	hsa-miR-548n	PAR-CLIP	23592263
MIRT492169	hsa-miR-371b-3p	PAR-CLIP	23592263
MIRT492168	hsa-miR-138-2-3p	PAR-CLIP	23592263
MIRT492166	hsa-miR-7158-5p	PAR-CLIP	23592263
MIRT492167	hsa-miR-4684-5p	PAR-CLIP	23592263
MIRT492165	hsa-miR-1178-3p	PAR-CLIP	23592263
MIRT492164	hsa-miR-4768-5p	PAR-CLIP	23592263
MIRT492163	hsa-miR-6833-3p	PAR-CLIP	23592263
MIRT492162	hsa-miR-6809-3p	PAR-CLIP	23592263
MIRT466961	hsa-miR-6871-3p	PAR-CLIP	23592263
MIRT466959	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT466960	hsa-miR-1288-5p	PAR-CLIP	23592263
MIRT466958	hsa-miR-922	PAR-CLIP	23592263
MIRT466956	hsa-miR-4270	PAR-CLIP	23592263
MIRT466957	hsa-miR-4441	PAR-CLIP	23592263
MIRT466955	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT466954	hsa-miR-7113-5p	PAR-CLIP	23592263
MIRT466953	hsa-miR-4685-5p	PAR-CLIP	23592263
MIRT466952	hsa-miR-6837-5p	PAR-CLIP	23592263
MIRT466951	hsa-miR-5681a	PAR-CLIP	23592263
MIRT466950	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT755549	hsa-miR-21a-5p	Luciferase reporter assayWestern blottingqRT-PCR	35259844
MIRT755671	hsa-miR-200c-5p	Western blottingqRT-PCR	37807322
MIRT755683	hsa-miR-30a-5p	Luciferase reporter assayqRT-PCR	38891028
MIRT735260	hsa-miR-29b-3p	Luciferase reporter assayWestern blottingqRT-PCR	36303071
MIRT755943	hsa-miR-323a-3p	Luciferase reporter assayWestern blottingqRT-PCR	37033189
MIRT735773	hsa-miR-4500	Luciferase reporter assayWestern blottingqRT-PCR	36246567
MIRT053229	hsa-miR-106a-5p	Luciferase reporter assayWestern blottingqRT-PCR	36437465
MIRT756315	rno-miR-21-5p	Western blotting	37641874
MIRT006959	hsa-miR-337-3p	Luciferase reporter assay	33896365
MIRT1395828	hsa-miR-106a	CLIP-seq
MIRT1395829	hsa-miR-106b	CLIP-seq
MIRT1395830	hsa-miR-1299	CLIP-seq
MIRT1395831	hsa-miR-17	CLIP-seq
MIRT1395832	hsa-miR-181a	CLIP-seq
MIRT1395833	hsa-miR-181b	CLIP-seq
MIRT1395834	hsa-miR-181c	CLIP-seq
MIRT1395835	hsa-miR-181d	CLIP-seq
MIRT1395836	hsa-miR-20a	CLIP-seq
MIRT1395837	hsa-miR-20b	CLIP-seq
MIRT1395838	hsa-miR-4262	CLIP-seq
MIRT1395839	hsa-miR-519d	CLIP-seq
MIRT1395840	hsa-miR-548c-3p	CLIP-seq
MIRT1395841	hsa-miR-548t	CLIP-seq
MIRT1395842	hsa-miR-875-3p	CLIP-seq
MIRT1395843	hsa-miR-93	CLIP-seq
MIRT1395828	hsa-miR-106a	CLIP-seq
MIRT1395829	hsa-miR-106b	CLIP-seq
MIRT1395844	hsa-miR-10a	CLIP-seq
MIRT1395845	hsa-miR-10b	CLIP-seq
MIRT1395846	hsa-miR-1193	CLIP-seq
MIRT1395847	hsa-miR-1207-3p	CLIP-seq
MIRT1395848	hsa-miR-1207-5p	CLIP-seq
MIRT1395849	hsa-miR-1234	CLIP-seq
MIRT1395850	hsa-miR-1251	CLIP-seq
MIRT1395851	hsa-miR-1256	CLIP-seq
MIRT1395852	hsa-miR-1287	CLIP-seq
MIRT1395853	hsa-miR-130a	CLIP-seq
MIRT1395854	hsa-miR-130b	CLIP-seq
MIRT1395855	hsa-miR-150	CLIP-seq
MIRT1395856	hsa-miR-1587	CLIP-seq
MIRT1395831	hsa-miR-17	CLIP-seq
MIRT1395857	hsa-miR-1827	CLIP-seq
MIRT1395858	hsa-miR-1909	CLIP-seq
MIRT1395859	hsa-miR-196a	CLIP-seq
MIRT1395860	hsa-miR-196b	CLIP-seq
MIRT1395861	hsa-miR-1976	CLIP-seq
MIRT1395862	hsa-miR-2052	CLIP-seq
MIRT1395836	hsa-miR-20a	CLIP-seq
MIRT1395837	hsa-miR-20b	CLIP-seq
MIRT1395863	hsa-miR-21	CLIP-seq
MIRT1395864	hsa-miR-2392	CLIP-seq
MIRT1395865	hsa-miR-29a	CLIP-seq
MIRT1395866	hsa-miR-29b	CLIP-seq
MIRT1395867	hsa-miR-29c	CLIP-seq
MIRT1395868	hsa-miR-301a	CLIP-seq
MIRT1395869	hsa-miR-301b	CLIP-seq
MIRT1395870	hsa-miR-302a	CLIP-seq
MIRT1395871	hsa-miR-302b	CLIP-seq
MIRT1395872	hsa-miR-302c	CLIP-seq
MIRT1395873	hsa-miR-302d	CLIP-seq
MIRT1395874	hsa-miR-302e	CLIP-seq
MIRT1395875	hsa-miR-3135b	CLIP-seq
MIRT1395876	hsa-miR-3150a-3p	CLIP-seq
MIRT1395877	hsa-miR-3152-3p	CLIP-seq
MIRT1395878	hsa-miR-3169	CLIP-seq
MIRT1395879	hsa-miR-3173-3p	CLIP-seq
MIRT1395880	hsa-miR-3175	CLIP-seq
MIRT1395881	hsa-miR-3180	CLIP-seq
MIRT1395882	hsa-miR-3180-3p	CLIP-seq
MIRT1395883	hsa-miR-3194-3p	CLIP-seq
MIRT1395884	hsa-miR-3196	CLIP-seq
MIRT1395885	hsa-miR-320a	CLIP-seq
MIRT1395886	hsa-miR-320b	CLIP-seq
MIRT1395887	hsa-miR-320c	CLIP-seq
MIRT1395888	hsa-miR-320d	CLIP-seq
MIRT1395889	hsa-miR-340	CLIP-seq
MIRT1395890	hsa-miR-34a	CLIP-seq
MIRT1395891	hsa-miR-34c-5p	CLIP-seq
MIRT1395892	hsa-miR-361-5p	CLIP-seq
MIRT1395893	hsa-miR-3616-3p	CLIP-seq
MIRT1395894	hsa-miR-3659	CLIP-seq
MIRT1395895	hsa-miR-3666	CLIP-seq
MIRT1395896	hsa-miR-3668	CLIP-seq
MIRT1395897	hsa-miR-3677-5p	CLIP-seq
MIRT1395898	hsa-miR-3688-5p	CLIP-seq
MIRT1395899	hsa-miR-372	CLIP-seq
MIRT1395900	hsa-miR-373	CLIP-seq
MIRT1395901	hsa-miR-383	CLIP-seq
MIRT1395902	hsa-miR-3924	CLIP-seq
MIRT1395903	hsa-miR-3925-3p	CLIP-seq
MIRT1395904	hsa-miR-3927	CLIP-seq
MIRT1395905	hsa-miR-3938	CLIP-seq
MIRT1395906	hsa-miR-425	CLIP-seq
MIRT1395907	hsa-miR-4251	CLIP-seq
MIRT1395908	hsa-miR-4279	CLIP-seq
MIRT1395909	hsa-miR-4295	CLIP-seq
MIRT1395910	hsa-miR-4422	CLIP-seq
MIRT1395911	hsa-miR-4429	CLIP-seq
MIRT1395912	hsa-miR-4433	CLIP-seq
MIRT1395913	hsa-miR-4434	CLIP-seq
MIRT1395914	hsa-miR-4435	CLIP-seq
MIRT1395915	hsa-miR-4436a	CLIP-seq
MIRT1395916	hsa-miR-4436b-3p	CLIP-seq
MIRT1395917	hsa-miR-4450	CLIP-seq
MIRT1395918	hsa-miR-4454	CLIP-seq
MIRT1395919	hsa-miR-4459	CLIP-seq
MIRT1395920	hsa-miR-4492	CLIP-seq
MIRT1395921	hsa-miR-4498	CLIP-seq
MIRT1395922	hsa-miR-449a	CLIP-seq
MIRT1395923	hsa-miR-449b	CLIP-seq
MIRT1395924	hsa-miR-4505	CLIP-seq
MIRT1395925	hsa-miR-4511	CLIP-seq
MIRT1395926	hsa-miR-4514	CLIP-seq
MIRT1395927	hsa-miR-4515	CLIP-seq
MIRT1395928	hsa-miR-4531	CLIP-seq
MIRT1395929	hsa-miR-454	CLIP-seq
MIRT1395930	hsa-miR-4638-5p	CLIP-seq
MIRT1395931	hsa-miR-4645-5p	CLIP-seq
MIRT1395932	hsa-miR-4649-3p	CLIP-seq
MIRT1395933	hsa-miR-4652-3p	CLIP-seq
MIRT1395934	hsa-miR-4652-5p	CLIP-seq
MIRT1395935	hsa-miR-4655-3p	CLIP-seq
MIRT1395936	hsa-miR-4656	CLIP-seq
MIRT1395937	hsa-miR-4662a-5p	CLIP-seq
MIRT1395938	hsa-miR-4663	CLIP-seq
MIRT1395939	hsa-miR-4667-5p	CLIP-seq
MIRT1395940	hsa-miR-4673	CLIP-seq
MIRT1395941	hsa-miR-4675	CLIP-seq
MIRT1395942	hsa-miR-4676-5p	CLIP-seq
MIRT1395943	hsa-miR-4687-3p	CLIP-seq
MIRT1395944	hsa-miR-4690-5p	CLIP-seq
MIRT1395945	hsa-miR-4692	CLIP-seq
MIRT1395946	hsa-miR-4695-3p	CLIP-seq
MIRT1395947	hsa-miR-4695-5p	CLIP-seq
MIRT1395948	hsa-miR-4700-5p	CLIP-seq
MIRT1395949	hsa-miR-4709-3p	CLIP-seq
MIRT1395950	hsa-miR-4716-3p	CLIP-seq
MIRT1395951	hsa-miR-4722-3p	CLIP-seq
MIRT1395952	hsa-miR-4722-5p	CLIP-seq
MIRT1395953	hsa-miR-4724-5p	CLIP-seq
MIRT1395954	hsa-miR-4728-5p	CLIP-seq
MIRT1395955	hsa-miR-4731-5p	CLIP-seq
MIRT1395956	hsa-miR-4740-3p	CLIP-seq
MIRT1395957	hsa-miR-4741	CLIP-seq
MIRT1395958	hsa-miR-4755-3p	CLIP-seq
MIRT1395959	hsa-miR-4761-5p	CLIP-seq
MIRT1395960	hsa-miR-4763-3p	CLIP-seq
MIRT1395961	hsa-miR-4764-5p	CLIP-seq
MIRT1395962	hsa-miR-4772-5p	CLIP-seq
MIRT1395963	hsa-miR-4778-5p	CLIP-seq
MIRT1395964	hsa-miR-4779	CLIP-seq
MIRT1395965	hsa-miR-4795-3p	CLIP-seq
MIRT1395966	hsa-miR-4799-5p	CLIP-seq
MIRT1395967	hsa-miR-483-5p	CLIP-seq
MIRT1395968	hsa-miR-485-5p	CLIP-seq
MIRT1395969	hsa-miR-486-3p	CLIP-seq
MIRT1395970	hsa-miR-495	CLIP-seq
MIRT1395971	hsa-miR-498	CLIP-seq
MIRT1395972	hsa-miR-5096	CLIP-seq
MIRT1395973	hsa-miR-512-3p	CLIP-seq
MIRT1395974	hsa-miR-519a	CLIP-seq
MIRT1395975	hsa-miR-519b-3p	CLIP-seq
MIRT1395976	hsa-miR-519c-3p	CLIP-seq
MIRT1395839	hsa-miR-519d	CLIP-seq
MIRT1395977	hsa-miR-520a-3p	CLIP-seq
MIRT1395978	hsa-miR-520b	CLIP-seq
MIRT1395979	hsa-miR-520d-3p	CLIP-seq
MIRT1395980	hsa-miR-520e	CLIP-seq
MIRT1395981	hsa-miR-520g	CLIP-seq
MIRT1395982	hsa-miR-520h	CLIP-seq
MIRT1395983	hsa-miR-539	CLIP-seq
MIRT1395984	hsa-miR-545	CLIP-seq
MIRT1395985	hsa-miR-548b-3p	CLIP-seq
MIRT1395841	hsa-miR-548t	CLIP-seq
MIRT1395986	hsa-miR-575	CLIP-seq
MIRT1395987	hsa-miR-642a	CLIP-seq
MIRT1395988	hsa-miR-642b	CLIP-seq
MIRT1395989	hsa-miR-646	CLIP-seq
MIRT1395990	hsa-miR-665	CLIP-seq
MIRT1395991	hsa-miR-762	CLIP-seq
MIRT1395992	hsa-miR-766	CLIP-seq
MIRT1395993	hsa-miR-876-3p	CLIP-seq
MIRT1395843	hsa-miR-93	CLIP-seq
MIRT1395994	hsa-miR-935	CLIP-seq
MIRT1395995	hsa-miR-939	CLIP-seq
MIRT1395996	hsa-miR-940	CLIP-seq
MIRT1554212	hsa-miR-2861	CLIP-seq
MIRT1554213	hsa-miR-3918	CLIP-seq
MIRT1554214	hsa-miR-4512	CLIP-seq
MIRT1395939	hsa-miR-4667-5p	CLIP-seq
MIRT1395948	hsa-miR-4700-5p	CLIP-seq
MIRT1554215	hsa-miR-544b	CLIP-seq
MIRT1395846	hsa-miR-1193	CLIP-seq
MIRT1922413	hsa-miR-129-5p	CLIP-seq
MIRT1395861	hsa-miR-1976	CLIP-seq
MIRT1395864	hsa-miR-2392	CLIP-seq
MIRT1395877	hsa-miR-3152-3p	CLIP-seq
MIRT1922414	hsa-miR-411	CLIP-seq
MIRT1395918	hsa-miR-4454	CLIP-seq
MIRT1395937	hsa-miR-4662a-5p	CLIP-seq
MIRT1395942	hsa-miR-4676-5p	CLIP-seq
MIRT1395946	hsa-miR-4695-3p	CLIP-seq
MIRT1395967	hsa-miR-483-5p	CLIP-seq
MIRT1395972	hsa-miR-5096	CLIP-seq
MIRT1395986	hsa-miR-575	CLIP-seq
MIRT1395846	hsa-miR-1193	CLIP-seq
MIRT1395861	hsa-miR-1976	CLIP-seq
MIRT1395864	hsa-miR-2392	CLIP-seq
MIRT1395877	hsa-miR-3152-3p	CLIP-seq
MIRT1922414	hsa-miR-411	CLIP-seq
MIRT1395918	hsa-miR-4454	CLIP-seq
MIRT1395937	hsa-miR-4662a-5p	CLIP-seq
MIRT1395942	hsa-miR-4676-5p	CLIP-seq
MIRT1395946	hsa-miR-4695-3p	CLIP-seq
MIRT1395967	hsa-miR-483-5p	CLIP-seq
MIRT1395972	hsa-miR-5096	CLIP-seq
MIRT1395986	hsa-miR-575	CLIP-seq
MIRT1395844	hsa-miR-10a	CLIP-seq
MIRT1395845	hsa-miR-10b	CLIP-seq
MIRT2118698	hsa-miR-1206	CLIP-seq
MIRT2118699	hsa-miR-122	CLIP-seq
MIRT1395851	hsa-miR-1256	CLIP-seq
MIRT2118700	hsa-miR-1303	CLIP-seq
MIRT1395861	hsa-miR-1976	CLIP-seq
MIRT1395863	hsa-miR-21	CLIP-seq
MIRT1395864	hsa-miR-2392	CLIP-seq
MIRT2118701	hsa-miR-3123	CLIP-seq
MIRT1395878	hsa-miR-3169	CLIP-seq
MIRT1395879	hsa-miR-3173-3p	CLIP-seq
MIRT1395881	hsa-miR-3180	CLIP-seq
MIRT1395882	hsa-miR-3180-3p	CLIP-seq
MIRT1395884	hsa-miR-3196	CLIP-seq
MIRT2118702	hsa-miR-3612	CLIP-seq
MIRT2118703	hsa-miR-3919	CLIP-seq
MIRT1395903	hsa-miR-3925-3p	CLIP-seq
MIRT2118704	hsa-miR-3925-5p	CLIP-seq
MIRT2118705	hsa-miR-3944-5p	CLIP-seq
MIRT2118706	hsa-miR-4269	CLIP-seq
MIRT2118707	hsa-miR-4302	CLIP-seq
MIRT2118708	hsa-miR-4330	CLIP-seq
MIRT1395919	hsa-miR-4459	CLIP-seq
MIRT1395926	hsa-miR-4514	CLIP-seq
MIRT1395927	hsa-miR-4515	CLIP-seq
MIRT2118709	hsa-miR-4534	CLIP-seq
MIRT1395931	hsa-miR-4645-5p	CLIP-seq
MIRT2118710	hsa-miR-4670-3p	CLIP-seq
MIRT1395940	hsa-miR-4673	CLIP-seq
MIRT1395942	hsa-miR-4676-5p	CLIP-seq
MIRT1395945	hsa-miR-4692	CLIP-seq
MIRT1395947	hsa-miR-4695-5p	CLIP-seq
MIRT1395952	hsa-miR-4722-5p	CLIP-seq
MIRT2118711	hsa-miR-4733-3p	CLIP-seq
MIRT2118712	hsa-miR-4756-3p	CLIP-seq
MIRT2118713	hsa-miR-4760-3p	CLIP-seq
MIRT1395959	hsa-miR-4761-5p	CLIP-seq
MIRT2118714	hsa-miR-493	CLIP-seq
MIRT2118715	hsa-miR-513a-3p	CLIP-seq
MIRT1395986	hsa-miR-575	CLIP-seq
MIRT2118716	hsa-miR-600	CLIP-seq
MIRT2118717	hsa-miR-648	CLIP-seq
MIRT2118718	hsa-miR-650	CLIP-seq
MIRT1395990	hsa-miR-665	CLIP-seq
MIRT1395992	hsa-miR-766	CLIP-seq
MIRT1395993	hsa-miR-876-3p	CLIP-seq
MIRT1395996	hsa-miR-940	CLIP-seq
MIRT1395850	hsa-miR-1251	CLIP-seq
MIRT1395919	hsa-miR-4459	CLIP-seq
MIRT1395988	hsa-miR-642b	CLIP-seq
MIRT1395828	hsa-miR-106a	CLIP-seq
MIRT1395829	hsa-miR-106b	CLIP-seq
MIRT1395844	hsa-miR-10a	CLIP-seq
MIRT1395845	hsa-miR-10b	CLIP-seq
MIRT1395846	hsa-miR-1193	CLIP-seq
MIRT1395847	hsa-miR-1207-3p	CLIP-seq
MIRT1395848	hsa-miR-1207-5p	CLIP-seq
MIRT2118699	hsa-miR-122	CLIP-seq
MIRT2340934	hsa-miR-124	CLIP-seq
MIRT2340935	hsa-miR-1245b-3p	CLIP-seq
MIRT2340936	hsa-miR-1266	CLIP-seq
MIRT1395852	hsa-miR-1287	CLIP-seq
MIRT2340937	hsa-miR-1301	CLIP-seq
MIRT1395853	hsa-miR-130a	CLIP-seq
MIRT1395854	hsa-miR-130b	CLIP-seq
MIRT1395831	hsa-miR-17	CLIP-seq
MIRT1395857	hsa-miR-1827	CLIP-seq
MIRT2340938	hsa-miR-1913	CLIP-seq
MIRT1395859	hsa-miR-196a	CLIP-seq
MIRT1395860	hsa-miR-196b	CLIP-seq
MIRT1395861	hsa-miR-1976	CLIP-seq
MIRT1395862	hsa-miR-2052	CLIP-seq
MIRT1395836	hsa-miR-20a	CLIP-seq
MIRT1395837	hsa-miR-20b	CLIP-seq
MIRT1395863	hsa-miR-21	CLIP-seq
MIRT2340939	hsa-miR-2116	CLIP-seq
MIRT2340940	hsa-miR-219-1-3p	CLIP-seq
MIRT1395864	hsa-miR-2392	CLIP-seq
MIRT1395868	hsa-miR-301a	CLIP-seq
MIRT1395869	hsa-miR-301b	CLIP-seq
MIRT1395875	hsa-miR-3135b	CLIP-seq
MIRT1395877	hsa-miR-3152-3p	CLIP-seq
MIRT2340941	hsa-miR-3161	CLIP-seq
MIRT1395879	hsa-miR-3173-3p	CLIP-seq
MIRT2340942	hsa-miR-324-3p	CLIP-seq
MIRT1395889	hsa-miR-340	CLIP-seq
MIRT2118702	hsa-miR-3612	CLIP-seq
MIRT1395892	hsa-miR-361-5p	CLIP-seq
MIRT1395894	hsa-miR-3659	CLIP-seq
MIRT2340943	hsa-miR-3664-3p	CLIP-seq
MIRT1395895	hsa-miR-3666	CLIP-seq
MIRT1395896	hsa-miR-3668	CLIP-seq
MIRT2340944	hsa-miR-3673	CLIP-seq
MIRT2340945	hsa-miR-3680	CLIP-seq
MIRT2340946	hsa-miR-3692	CLIP-seq
MIRT2340947	hsa-miR-3714	CLIP-seq
MIRT1395901	hsa-miR-383	CLIP-seq
MIRT2340948	hsa-miR-3910	CLIP-seq
MIRT2118703	hsa-miR-3919	CLIP-seq
MIRT1395902	hsa-miR-3924	CLIP-seq
MIRT1395904	hsa-miR-3927	CLIP-seq
MIRT1395905	hsa-miR-3938	CLIP-seq
MIRT2340949	hsa-miR-3942-3p	CLIP-seq
MIRT1922414	hsa-miR-411	CLIP-seq
MIRT1395908	hsa-miR-4279	CLIP-seq
MIRT1395909	hsa-miR-4295	CLIP-seq
MIRT2118707	hsa-miR-4302	CLIP-seq
MIRT1395912	hsa-miR-4433	CLIP-seq
MIRT1395913	hsa-miR-4434	CLIP-seq
MIRT1395919	hsa-miR-4459	CLIP-seq
MIRT2340950	hsa-miR-4494	CLIP-seq
MIRT2340951	hsa-miR-4506	CLIP-seq
MIRT2340952	hsa-miR-4518	CLIP-seq
MIRT1395928	hsa-miR-4531	CLIP-seq
MIRT2118709	hsa-miR-4534	CLIP-seq
MIRT1395929	hsa-miR-454	CLIP-seq
MIRT2340953	hsa-miR-4640-5p	CLIP-seq
MIRT2340954	hsa-miR-4643	CLIP-seq
MIRT1395932	hsa-miR-4649-3p	CLIP-seq
MIRT1395933	hsa-miR-4652-3p	CLIP-seq
MIRT1395935	hsa-miR-4655-3p	CLIP-seq
MIRT2340955	hsa-miR-466	CLIP-seq
MIRT2340956	hsa-miR-4660	CLIP-seq
MIRT1395937	hsa-miR-4662a-5p	CLIP-seq
MIRT1395939	hsa-miR-4667-5p	CLIP-seq
MIRT1395942	hsa-miR-4676-5p	CLIP-seq
MIRT2340957	hsa-miR-4677-5p	CLIP-seq
MIRT1395943	hsa-miR-4687-3p	CLIP-seq
MIRT1395946	hsa-miR-4695-3p	CLIP-seq
MIRT1395947	hsa-miR-4695-5p	CLIP-seq
MIRT1395948	hsa-miR-4700-5p	CLIP-seq
MIRT2340958	hsa-miR-4704-5p	CLIP-seq
MIRT1395949	hsa-miR-4709-3p	CLIP-seq
MIRT2340959	hsa-miR-4714-5p	CLIP-seq
MIRT1395951	hsa-miR-4722-3p	CLIP-seq
MIRT1395953	hsa-miR-4724-5p	CLIP-seq
MIRT2340960	hsa-miR-4726-5p	CLIP-seq
MIRT1395955	hsa-miR-4731-5p	CLIP-seq
MIRT2118711	hsa-miR-4733-3p	CLIP-seq
MIRT2340961	hsa-miR-4735-5p	CLIP-seq
MIRT1395956	hsa-miR-4740-3p	CLIP-seq
MIRT2340962	hsa-miR-4753-5p	CLIP-seq
MIRT1395958	hsa-miR-4755-3p	CLIP-seq
MIRT1395959	hsa-miR-4761-5p	CLIP-seq
MIRT1395960	hsa-miR-4763-3p	CLIP-seq
MIRT1395961	hsa-miR-4764-5p	CLIP-seq
MIRT1395962	hsa-miR-4772-5p	CLIP-seq
MIRT2340963	hsa-miR-4775	CLIP-seq
MIRT1395963	hsa-miR-4778-5p	CLIP-seq
MIRT2340964	hsa-miR-4789-3p	CLIP-seq
MIRT1395965	hsa-miR-4795-3p	CLIP-seq
MIRT2340965	hsa-miR-4798-3p	CLIP-seq
MIRT1395966	hsa-miR-4799-5p	CLIP-seq
MIRT1395967	hsa-miR-483-5p	CLIP-seq
MIRT2340966	hsa-miR-494	CLIP-seq
MIRT1395971	hsa-miR-498	CLIP-seq
MIRT2340967	hsa-miR-5047	CLIP-seq
MIRT2340968	hsa-miR-506	CLIP-seq
MIRT1395972	hsa-miR-5096	CLIP-seq
MIRT1395974	hsa-miR-519a	CLIP-seq
MIRT1395975	hsa-miR-519b-3p	CLIP-seq
MIRT1395976	hsa-miR-519c-3p	CLIP-seq
MIRT1395839	hsa-miR-519d	CLIP-seq
MIRT2340969	hsa-miR-520a-5p	CLIP-seq
MIRT2340970	hsa-miR-525-5p	CLIP-seq
MIRT1554215	hsa-miR-544b	CLIP-seq
MIRT1395984	hsa-miR-545	CLIP-seq
MIRT1395841	hsa-miR-548t	CLIP-seq
MIRT2340971	hsa-miR-550b	CLIP-seq
MIRT2340972	hsa-miR-571	CLIP-seq
MIRT1395986	hsa-miR-575	CLIP-seq
MIRT2340973	hsa-miR-590-3p	CLIP-seq
MIRT1395987	hsa-miR-642a	CLIP-seq
MIRT2118718	hsa-miR-650	CLIP-seq
MIRT1395990	hsa-miR-665	CLIP-seq
MIRT2340974	hsa-miR-874	CLIP-seq
MIRT1395993	hsa-miR-876-3p	CLIP-seq
MIRT1395843	hsa-miR-93	CLIP-seq
MIRT1395994	hsa-miR-935	CLIP-seq
MIRT2118713	hsa-miR-4760-3p	CLIP-seq
MIRT1395863	hsa-miR-21	CLIP-seq
MIRT1395863	hsa-miR-21	CLIP-seq
MIRT1395919	hsa-miR-4459	CLIP-seq
MIRT2340963	hsa-miR-4775	CLIP-seq
MIRT2442714	hsa-miR-24	CLIP-seq
MIRT2118705	hsa-miR-3944-5p	CLIP-seq
MIRT2442715	hsa-miR-4284	CLIP-seq
MIRT1395959	hsa-miR-4761-5p	CLIP-seq
MIRT2442716	hsa-miR-4772-3p	CLIP-seq
MIRT2340963	hsa-miR-4775	CLIP-seq
MIRT1395965	hsa-miR-4795-3p	CLIP-seq
MIRT2340936	hsa-miR-1266	CLIP-seq
MIRT1395861	hsa-miR-1976	CLIP-seq
MIRT2340943	hsa-miR-3664-3p	CLIP-seq
MIRT1395908	hsa-miR-4279	CLIP-seq
MIRT2340952	hsa-miR-4518	CLIP-seq
MIRT1395951	hsa-miR-4722-3p	CLIP-seq
MIRT1395971	hsa-miR-498	CLIP-seq
MIRT2340963	hsa-miR-4775	CLIP-seq
MIRT1395828	hsa-miR-106a	CLIP-seq
MIRT1395829	hsa-miR-106b	CLIP-seq
MIRT1395844	hsa-miR-10a	CLIP-seq
MIRT1395845	hsa-miR-10b	CLIP-seq
MIRT2118698	hsa-miR-1206	CLIP-seq
MIRT1395847	hsa-miR-1207-3p	CLIP-seq
MIRT2118699	hsa-miR-122	CLIP-seq
MIRT2634838	hsa-miR-1249	CLIP-seq
MIRT2634839	hsa-miR-1264	CLIP-seq
MIRT2340936	hsa-miR-1266	CLIP-seq
MIRT1922413	hsa-miR-129-5p	CLIP-seq
MIRT2118700	hsa-miR-1303	CLIP-seq
MIRT1395853	hsa-miR-130a	CLIP-seq
MIRT1395854	hsa-miR-130b	CLIP-seq
MIRT1395831	hsa-miR-17	CLIP-seq
MIRT1395857	hsa-miR-1827	CLIP-seq
MIRT2340938	hsa-miR-1913	CLIP-seq
MIRT1395861	hsa-miR-1976	CLIP-seq
MIRT1395862	hsa-miR-2052	CLIP-seq
MIRT1395836	hsa-miR-20a	CLIP-seq
MIRT1395837	hsa-miR-20b	CLIP-seq
MIRT2340940	hsa-miR-219-1-3p	CLIP-seq
MIRT1395864	hsa-miR-2392	CLIP-seq
MIRT2442714	hsa-miR-24	CLIP-seq
MIRT1395868	hsa-miR-301a	CLIP-seq
MIRT1395869	hsa-miR-301b	CLIP-seq
MIRT2118701	hsa-miR-3123	CLIP-seq
MIRT2634840	hsa-miR-3157-3p	CLIP-seq
MIRT2634841	hsa-miR-3158-3p	CLIP-seq
MIRT2634842	hsa-miR-3163	CLIP-seq
MIRT1395878	hsa-miR-3169	CLIP-seq
MIRT1395881	hsa-miR-3180	CLIP-seq
MIRT1395882	hsa-miR-3180-3p	CLIP-seq
MIRT1395884	hsa-miR-3196	CLIP-seq
MIRT2634843	hsa-miR-323-3p	CLIP-seq
MIRT2634844	hsa-miR-323b-3p	CLIP-seq
MIRT2340942	hsa-miR-324-3p	CLIP-seq
MIRT2634845	hsa-miR-338-3p	CLIP-seq
MIRT2634846	hsa-miR-338-5p	CLIP-seq
MIRT1395889	hsa-miR-340	CLIP-seq
MIRT2634847	hsa-miR-3662	CLIP-seq
MIRT2340943	hsa-miR-3664-3p	CLIP-seq
MIRT1395895	hsa-miR-3666	CLIP-seq
MIRT2340945	hsa-miR-3680	CLIP-seq
MIRT2340946	hsa-miR-3692	CLIP-seq
MIRT1395901	hsa-miR-383	CLIP-seq
MIRT2118703	hsa-miR-3919	CLIP-seq
MIRT2634848	hsa-miR-3921	CLIP-seq
MIRT1395903	hsa-miR-3925-3p	CLIP-seq
MIRT2118704	hsa-miR-3925-5p	CLIP-seq
MIRT2118705	hsa-miR-3944-5p	CLIP-seq
MIRT2634849	hsa-miR-4257	CLIP-seq
MIRT1395908	hsa-miR-4279	CLIP-seq
MIRT2442715	hsa-miR-4284	CLIP-seq
MIRT1395909	hsa-miR-4295	CLIP-seq
MIRT2118707	hsa-miR-4302	CLIP-seq
MIRT2634850	hsa-miR-4446-3p	CLIP-seq
MIRT1395919	hsa-miR-4459	CLIP-seq
MIRT1395926	hsa-miR-4514	CLIP-seq
MIRT1395927	hsa-miR-4515	CLIP-seq
MIRT2340952	hsa-miR-4518	CLIP-seq
MIRT2634851	hsa-miR-4530	CLIP-seq
MIRT2118709	hsa-miR-4534	CLIP-seq
MIRT1395929	hsa-miR-454	CLIP-seq
MIRT2634852	hsa-miR-4540	CLIP-seq
MIRT1395931	hsa-miR-4645-5p	CLIP-seq
MIRT1395932	hsa-miR-4649-3p	CLIP-seq
MIRT2634853	hsa-miR-4653-5p	CLIP-seq
MIRT1395940	hsa-miR-4673	CLIP-seq
MIRT2634854	hsa-miR-4682	CLIP-seq
MIRT2634855	hsa-miR-4686	CLIP-seq
MIRT2634856	hsa-miR-4690-3p	CLIP-seq
MIRT1395945	hsa-miR-4692	CLIP-seq
MIRT2340959	hsa-miR-4714-5p	CLIP-seq
MIRT1395951	hsa-miR-4722-3p	CLIP-seq
MIRT1395952	hsa-miR-4722-5p	CLIP-seq
MIRT2340961	hsa-miR-4735-5p	CLIP-seq
MIRT1395956	hsa-miR-4740-3p	CLIP-seq
MIRT2340962	hsa-miR-4753-5p	CLIP-seq
MIRT2118712	hsa-miR-4756-3p	CLIP-seq
MIRT2118713	hsa-miR-4760-3p	CLIP-seq
MIRT1395959	hsa-miR-4761-5p	CLIP-seq
MIRT1395961	hsa-miR-4764-5p	CLIP-seq
MIRT2442716	hsa-miR-4772-3p	CLIP-seq
MIRT1395962	hsa-miR-4772-5p	CLIP-seq
MIRT2340963	hsa-miR-4775	CLIP-seq
MIRT2634857	hsa-miR-4786-5p	CLIP-seq
MIRT1395965	hsa-miR-4795-3p	CLIP-seq
MIRT2340965	hsa-miR-4798-3p	CLIP-seq
MIRT2118714	hsa-miR-493	CLIP-seq
MIRT2340966	hsa-miR-494	CLIP-seq
MIRT1395970	hsa-miR-495	CLIP-seq
MIRT1395971	hsa-miR-498	CLIP-seq
MIRT1395974	hsa-miR-519a	CLIP-seq
MIRT1395975	hsa-miR-519b-3p	CLIP-seq
MIRT1395976	hsa-miR-519c-3p	CLIP-seq
MIRT1395839	hsa-miR-519d	CLIP-seq
MIRT2340969	hsa-miR-520a-5p	CLIP-seq
MIRT2634858	hsa-miR-520d-5p	CLIP-seq
MIRT2634859	hsa-miR-521	CLIP-seq
MIRT2634860	hsa-miR-524-5p	CLIP-seq
MIRT2340970	hsa-miR-525-5p	CLIP-seq
MIRT1395984	hsa-miR-545	CLIP-seq
MIRT1395841	hsa-miR-548t	CLIP-seq
MIRT2340971	hsa-miR-550b	CLIP-seq
MIRT2340972	hsa-miR-571	CLIP-seq
MIRT2340973	hsa-miR-590-3p	CLIP-seq
MIRT1395988	hsa-miR-642b	CLIP-seq
MIRT2118717	hsa-miR-648	CLIP-seq
MIRT1395992	hsa-miR-766	CLIP-seq
MIRT2634861	hsa-miR-767-3p	CLIP-seq
MIRT2340974	hsa-miR-874	CLIP-seq
MIRT1395993	hsa-miR-876-3p	CLIP-seq
MIRT1395843	hsa-miR-93	CLIP-seq
MIRT2634862	hsa-miR-938	CLIP-seq
MIRT1395996	hsa-miR-940	CLIP-seq
MIRT1395828	hsa-miR-106a	CLIP-seq
MIRT1395829	hsa-miR-106b	CLIP-seq
MIRT1395844	hsa-miR-10a	CLIP-seq
MIRT1395845	hsa-miR-10b	CLIP-seq
MIRT2118698	hsa-miR-1206	CLIP-seq
MIRT1395847	hsa-miR-1207-3p	CLIP-seq
MIRT2118699	hsa-miR-122	CLIP-seq
MIRT2634838	hsa-miR-1249	CLIP-seq
MIRT2692200	hsa-miR-1255a	CLIP-seq
MIRT2692201	hsa-miR-1255b	CLIP-seq
MIRT2634839	hsa-miR-1264	CLIP-seq
MIRT2340936	hsa-miR-1266	CLIP-seq
MIRT1922413	hsa-miR-129-5p	CLIP-seq
MIRT2118700	hsa-miR-1303	CLIP-seq
MIRT1395853	hsa-miR-130a	CLIP-seq
MIRT1395854	hsa-miR-130b	CLIP-seq
MIRT1395831	hsa-miR-17	CLIP-seq
MIRT1395857	hsa-miR-1827	CLIP-seq
MIRT2340938	hsa-miR-1913	CLIP-seq
MIRT1395861	hsa-miR-1976	CLIP-seq
MIRT1395862	hsa-miR-2052	CLIP-seq
MIRT1395836	hsa-miR-20a	CLIP-seq
MIRT1395837	hsa-miR-20b	CLIP-seq
MIRT1395863	hsa-miR-21	CLIP-seq
MIRT2340940	hsa-miR-219-1-3p	CLIP-seq
MIRT1395864	hsa-miR-2392	CLIP-seq
MIRT2442714	hsa-miR-24	CLIP-seq
MIRT1395868	hsa-miR-301a	CLIP-seq
MIRT1395869	hsa-miR-301b	CLIP-seq
MIRT2118701	hsa-miR-3123	CLIP-seq
MIRT2634840	hsa-miR-3157-3p	CLIP-seq
MIRT2634841	hsa-miR-3158-3p	CLIP-seq
MIRT2634842	hsa-miR-3163	CLIP-seq
MIRT1395878	hsa-miR-3169	CLIP-seq
MIRT1395881	hsa-miR-3180	CLIP-seq
MIRT1395882	hsa-miR-3180-3p	CLIP-seq
MIRT1395884	hsa-miR-3196	CLIP-seq
MIRT2634843	hsa-miR-323-3p	CLIP-seq
MIRT2634844	hsa-miR-323b-3p	CLIP-seq
MIRT2340942	hsa-miR-324-3p	CLIP-seq
MIRT2634845	hsa-miR-338-3p	CLIP-seq
MIRT2634846	hsa-miR-338-5p	CLIP-seq
MIRT1395889	hsa-miR-340	CLIP-seq
MIRT2340943	hsa-miR-3664-3p	CLIP-seq
MIRT1395895	hsa-miR-3666	CLIP-seq
MIRT1395896	hsa-miR-3668	CLIP-seq
MIRT2340945	hsa-miR-3680	CLIP-seq
MIRT2340946	hsa-miR-3692	CLIP-seq
MIRT1395901	hsa-miR-383	CLIP-seq
MIRT2118703	hsa-miR-3919	CLIP-seq
MIRT2634848	hsa-miR-3921	CLIP-seq
MIRT1395903	hsa-miR-3925-3p	CLIP-seq
MIRT2118704	hsa-miR-3925-5p	CLIP-seq
MIRT2118705	hsa-miR-3944-5p	CLIP-seq
MIRT2634849	hsa-miR-4257	CLIP-seq
MIRT1395908	hsa-miR-4279	CLIP-seq
MIRT2442715	hsa-miR-4284	CLIP-seq
MIRT1395909	hsa-miR-4295	CLIP-seq
MIRT2118707	hsa-miR-4302	CLIP-seq
MIRT1395912	hsa-miR-4433	CLIP-seq
MIRT2634850	hsa-miR-4446-3p	CLIP-seq
MIRT1395919	hsa-miR-4459	CLIP-seq
MIRT1395926	hsa-miR-4514	CLIP-seq
MIRT1395927	hsa-miR-4515	CLIP-seq
MIRT2340952	hsa-miR-4518	CLIP-seq
MIRT2634851	hsa-miR-4530	CLIP-seq
MIRT2118709	hsa-miR-4534	CLIP-seq
MIRT1395929	hsa-miR-454	CLIP-seq
MIRT2634852	hsa-miR-4540	CLIP-seq
MIRT1395931	hsa-miR-4645-5p	CLIP-seq
MIRT1395932	hsa-miR-4649-3p	CLIP-seq
MIRT2634853	hsa-miR-4653-5p	CLIP-seq
MIRT1395940	hsa-miR-4673	CLIP-seq
MIRT2634854	hsa-miR-4682	CLIP-seq
MIRT2634855	hsa-miR-4686	CLIP-seq
MIRT2634856	hsa-miR-4690-3p	CLIP-seq
MIRT1395945	hsa-miR-4692	CLIP-seq
MIRT2340959	hsa-miR-4714-5p	CLIP-seq
MIRT1395951	hsa-miR-4722-3p	CLIP-seq
MIRT1395952	hsa-miR-4722-5p	CLIP-seq
MIRT2340961	hsa-miR-4735-5p	CLIP-seq
MIRT1395956	hsa-miR-4740-3p	CLIP-seq
MIRT2340962	hsa-miR-4753-5p	CLIP-seq
MIRT1395958	hsa-miR-4755-3p	CLIP-seq
MIRT2118712	hsa-miR-4756-3p	CLIP-seq
MIRT2118713	hsa-miR-4760-3p	CLIP-seq
MIRT1395959	hsa-miR-4761-5p	CLIP-seq
MIRT1395961	hsa-miR-4764-5p	CLIP-seq
MIRT2692202	hsa-miR-4768-3p	CLIP-seq
MIRT2442716	hsa-miR-4772-3p	CLIP-seq
MIRT1395962	hsa-miR-4772-5p	CLIP-seq
MIRT2340963	hsa-miR-4775	CLIP-seq
MIRT2634857	hsa-miR-4786-5p	CLIP-seq
MIRT1395965	hsa-miR-4795-3p	CLIP-seq
MIRT2340965	hsa-miR-4798-3p	CLIP-seq
MIRT2118714	hsa-miR-493	CLIP-seq
MIRT2340966	hsa-miR-494	CLIP-seq
MIRT1395970	hsa-miR-495	CLIP-seq
MIRT1395971	hsa-miR-498	CLIP-seq
MIRT1395974	hsa-miR-519a	CLIP-seq
MIRT1395975	hsa-miR-519b-3p	CLIP-seq
MIRT1395976	hsa-miR-519c-3p	CLIP-seq
MIRT1395839	hsa-miR-519d	CLIP-seq
MIRT2340969	hsa-miR-520a-5p	CLIP-seq
MIRT2634858	hsa-miR-520d-5p	CLIP-seq
MIRT2634859	hsa-miR-521	CLIP-seq
MIRT2634860	hsa-miR-524-5p	CLIP-seq
MIRT2340970	hsa-miR-525-5p	CLIP-seq
MIRT1395984	hsa-miR-545	CLIP-seq
MIRT1395841	hsa-miR-548t	CLIP-seq
MIRT2340971	hsa-miR-550b	CLIP-seq
MIRT2340972	hsa-miR-571	CLIP-seq
MIRT2340973	hsa-miR-590-3p	CLIP-seq
MIRT1395988	hsa-miR-642b	CLIP-seq
MIRT1395989	hsa-miR-646	CLIP-seq
MIRT2118717	hsa-miR-648	CLIP-seq
MIRT1395990	hsa-miR-665	CLIP-seq
MIRT1395992	hsa-miR-766	CLIP-seq
MIRT2634861	hsa-miR-767-3p	CLIP-seq
MIRT2692203	hsa-miR-769-5p	CLIP-seq
MIRT2340974	hsa-miR-874	CLIP-seq
MIRT1395993	hsa-miR-876-3p	CLIP-seq
MIRT1395843	hsa-miR-93	CLIP-seq
MIRT2634862	hsa-miR-938	CLIP-seq
MIRT1395996	hsa-miR-940	CLIP-seq

Show/Hide all (14)

Transcription factor	Regulation	Reference
BCL6	Unknown	17951530
BRCA1	Unknown	11163768
CEBPA	Unknown	24429361
HDAC1	Unknown	18611949
HIC1	Activation	24067369
HIF1A	Unknown	23991099
KAT5	Repression	12551922
PIAS3	Unknown	16098628
RELA	Unknown	25040843
SPI1	Unknown	24429361
STAT1	Unknown	22693070
TCF7L2	Unknown	18602747
TP53	Repression	11809683
ZNF382	Repression	20682794

237

Show/Hide all (237)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	8675499
GO:0000785	Component	Chromatin	IDA	16835372
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	17324931
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	19390056
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	17344214, 32929201
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IMP	38404237
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	16835372
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IGI	31886314
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	16946298
GO:0001659	Process	Temperature homeostasis	IEA
GO:0001659	Process	Temperature homeostasis	ISS
GO:0001666	Process	Response to hypoxia	IEA
GO:0001754	Process	Eye photoreceptor cell differentiation	ISS
GO:0001817	Process	Regulation of cytokine production	IEA
GO:0002931	Process	Response to ischemia	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	ISS
GO:0003700	Function	DNA-binding transcription factor activity	IC	7543512
GO:0003700	Function	DNA-binding transcription factor activity	IDA	7568001, 9535918, 15653507, 16285960, 17344214, 18782771, 28781374
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	7512451, 8675499
GO:0003723	Function	RNA binding	IPI	31507089
GO:0004879	Function	Nuclear receptor activity	IDA	17324931
GO:0005102	Function	Signaling receptor binding	IPI	31145836
GO:0005515	Function	Protein binding	IPI	8662591, 9864141, 10688651, 11536047, 11585385, 11940572, 11970898, 12867595, 14966128, 15286705, 15657067, 15764709, 15821101, 15998644, 16273093, 16306601, 16331268, 16364321, 16531398, 16568091, 18200042, 18234692, 18330356, 19345327, 19372587, 20133729, 20826784, 20871632, 20876
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	7543512, 7568001, 8756628, 28781374
GO:0005634	Component	Nucleus	IDA	7528668, 12743296, 15653507, 16285960, 17344214
GO:0005634	Component	Nucleus	IDA	12444102, 17324931, 17360477, 18234692, 22783022, 24846175, 28065600, 31899195
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IDA	24429361
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	12743296
GO:0005737	Component	Cytoplasm	IDA	15653507, 16285960, 17360477, 18234692, 22783022, 31899195
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005737	Component	Cytoplasm	TAS	7512451
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	15664994, 17344214
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	ISS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	7512451
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006606	Process	Protein import into nucleus	IDA	18234692
GO:0006952	Process	Defense response	IBA
GO:0006953	Process	Acute-phase response	IEA
GO:0006954	Process	Inflammatory response	IDA	10443688
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	ISS
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	7512451, 10205054
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IGI	28467929
GO:0007249	Process	Canonical NF-kappaB signal transduction	IDA	34721373
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IBA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	8272873
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	8272873
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	NAS	15864272, 24058793
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	TAS	9670957, 15664994
GO:0007399	Process	Nervous system development	TAS	10205054
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010507	Process	Negative regulation of autophagy	IDA	26962683
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IMP	25596740
GO:0010628	Process	Positive regulation of gene expression	IDA	23820254
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	24255059
GO:0010629	Process	Negative regulation of gene expression	IDA	23820254
GO:0010730	Process	Negative regulation of hydrogen peroxide biosynthetic process	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0016310	Process	Phosphorylation	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	NAS	12743296, 15664994
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	ISS
GO:0019903	Function	Protein phosphatase binding	IPI	12359225, 17360477
GO:0019953	Process	Sexual reproduction	IEA
GO:0019953	Process	Sexual reproduction	ISS
GO:0023019	Process	Signal transduction involved in regulation of gene expression	IDA	34721373
GO:0030154	Process	Cell differentiation	IDA	28781374
GO:0030335	Process	Positive regulation of cell migration	IMP	24846175, 31638206
GO:0030522	Process	Intracellular receptor signaling pathway	IDA	17324931
GO:0031490	Function	Chromatin DNA binding	IDA	17344214
GO:0031730	Function	CCR5 chemokine receptor binding	IEA
GO:0032355	Process	Response to estradiol	IDA	12552091
GO:0032355	Process	Response to estradiol	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IGI	31886314
GO:0032733	Process	Positive regulation of interleukin-10 production	IGI	31886314
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS
GO:0032757	Process	Positive regulation of interleukin-8 production	IGI	31886314
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IGI	31886314
GO:0032870	Process	Cellular response to hormone stimulus	IDA	12552091
GO:0032991	Component	Protein-containing complex	IEA
GO:0033210	Process	Leptin-mediated signaling pathway	IBA
GO:0033210	Process	Leptin-mediated signaling pathway	IDA	17344214
GO:0033210	Process	Leptin-mediated signaling pathway	IEA
GO:0034097	Process	Response to cytokine	IEA
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0035259	Function	Nuclear glucocorticoid receptor binding	IEA
GO:0035591	Function	Signaling adaptor activity	IPI	31145836
GO:0035723	Process	Interleukin-15-mediated signaling pathway	IDA	7568001
GO:0038110	Process	Interleukin-2-mediated signaling pathway	IDA	7568005
GO:0038113	Process	Interleukin-9-mediated signaling pathway	IDA	9535918
GO:0038154	Process	Interleukin-11-mediated signaling pathway	IDA	28781374
GO:0038155	Process	Interleukin-23-mediated signaling pathway	IDA	12023369
GO:0040014	Process	Regulation of multicellular organism growth	IEA
GO:0042127	Process	Regulation of cell population proliferation	IBA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042593	Process	Glucose homeostasis	ISS
GO:0042755	Process	Eating behavior	IEA
GO:0042755	Process	Eating behavior	ISS
GO:0042789	Process	MRNA transcription by RNA polymerase II	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	7510216, 17676033, 21988832, 25609649
GO:0042803	Function	Protein homodimerization activity	IDA	15653507
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	ISS
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IEA
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	ISS
GO:0043434	Process	Response to peptide hormone	IBA
GO:0043434	Process	Response to peptide hormone	IEA
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	27830702
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0044320	Process	Cellular response to leptin stimulus	IDA	17344214
GO:0044321	Process	Response to leptin	IDA	17344214
GO:0044321	Process	Response to leptin	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045648	Process	Positive regulation of erythrocyte differentiation	IMP	28283061
GO:0045747	Process	Positive regulation of Notch signaling pathway	IEA
GO:0045747	Process	Positive regulation of Notch signaling pathway	ISS
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045820	Process	Negative regulation of glycolytic process	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	19390056
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	17324931, 27050391
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	19754877, 24429361, 31886314
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	16835372, 16946298
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	NAS	15864272, 24058793
GO:0046902	Process	Regulation of mitochondrial membrane permeability	IEA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0046983	Function	Protein dimerization activity	ISS
GO:0048708	Process	Astrocyte differentiation	IEA
GO:0048708	Process	Astrocyte differentiation	ISS
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050728	Process	Negative regulation of inflammatory response	ISS
GO:0050729	Process	Positive regulation of inflammatory response	IDA	23125416
GO:0050766	Process	Positive regulation of phagocytosis	IDA	27994074
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0051240	Process	Positive regulation of multicellular organismal process	IEA
GO:0051726	Process	Regulation of cell cycle	IDA	17344214
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0060019	Process	Radial glial cell differentiation	IEA
GO:0060019	Process	Radial glial cell differentiation	ISS
GO:0060221	Process	Retinal rod cell differentiation	IEA
GO:0060259	Process	Regulation of feeding behavior	IEA
GO:0060259	Process	Regulation of feeding behavior	ISS
GO:0060396	Process	Growth hormone receptor signaling pathway	IDA	10925297
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	IBA
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	IDA	12552091
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	IEA
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	ISS
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	22783022, 24429361, 28467929
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IDA	8272873
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IDA	12359225, 12552091, 16285960, 17324931, 24429361
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IMP	16835372, 16946298
GO:0070878	Function	Primary miRNA binding	IPI	31507089
GO:0071345	Process	Cellular response to cytokine stimulus	IEA
GO:0072538	Process	T-helper 17 type immune response	IDA	31899195
GO:0072540	Process	T-helper 17 cell lineage commitment	IEA
GO:0072540	Process	T-helper 17 cell lineage commitment	ISS
GO:0072540	Process	T-helper 17 cell lineage commitment	TAS	27893700
GO:0090091	Process	Positive regulation of extracellular matrix disassembly	IGI	23820254
GO:0090575	Component	RNA polymerase II transcription regulator complex	IBA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IC	16835372
GO:0090575	Component	RNA polymerase II transcription regulator complex	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IMP	16946298
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	8662591, 17676033
GO:0090575	Component	RNA polymerase II transcription regulator complex	NAS	24058793
GO:0090594	Process	Inflammatory response to wounding	IDA	27830702
GO:0097009	Process	Energy homeostasis	IEA
GO:0097009	Process	Energy homeostasis	ISS
GO:0097398	Process	Cellular response to interleukin-17	IEA
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IMP	25596740
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099527	Process	Postsynapse to nucleus signaling pathway	IEA
GO:0106015	Process	Negative regulation of inflammatory response to wounding	IDA	27830702
GO:0106015	Process	Negative regulation of inflammatory response to wounding	IDA	27830702
GO:0106015	Process	Negative regulation of inflammatory response to wounding	IEA
GO:0106222	Function	LncRNA binding	IDA	24744378
GO:0140105	Process	Interleukin-10-mediated signaling pathway	IDA	7543512
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	15664994
GO:0140311	Function	Protein sequestering activity	IEA
GO:0140311	Function	Protein sequestering activity	ISS
GO:0140610	Function	RNA sequestering activity	IDA	31507089
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IDA	16968406, 21606497
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IEA
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	ISS
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IDA	8654373
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IGI	31886314
GO:1900037	Process	Regulation of cellular response to hypoxia	IEA
GO:1902728	Process	Positive regulation of growth factor dependent skeletal muscle satellite cell proliferation	IEA
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	19390056, 23820254
GO:1902895	Process	Positive regulation of miRNA transcription	IEA
GO:1905564	Process	Positive regulation of vascular endothelial cell proliferation	IEA
GO:1905869	Process	Negative regulation of 3'-UTR-mediated mRNA stabilization	IDA	21606497
GO:2000635	Process	Negative regulation of primary miRNA processing	IMP	31507089
GO:2000737	Process	Negative regulation of stem cell differentiation	IEA
GO:2001171	Process	Positive regulation of ATP biosynthetic process	IEA
GO:2001223	Process	Negative regulation of neuron migration	IEA

MIM	HGNC	e!Ensembl
102582	11364	ENSG00000168610

P40763

Protein name

Signal transducer and activator of transcription 3 (Acute-phase response factor)

Protein function

Signal transducer and transcription activator that mediates cellular responses to interleukins, KITLG/SCF, LEP and other growth factors (PubMed:10688651, PubMed:12359225, PubMed:12873986, PubMed:15194700, PubMed:15653507, PubMed:16285960, PubMed

PDB

5AX3 , 5U5S , 6NJS , 6NUQ , 6QHD , 6TLC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02865	STAT_int	2 → 120	STAT protein, protein interaction domain	Domain
PF01017	STAT_alpha	141 → 313	STAT protein, all-alpha domain	Family
PF02864	STAT_bind	325 → 464	STAT protein, DNA binding domain	Domain
PF00017	SH2	584 → 674	SH2 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Expressed in naive CD4(+) T cells as well as T-helper Th17, Th1 and Th2 cells (PubMed:31899195). {ECO:0000269|PubMed:31899195}.

Sequence

MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM

Sequence length

770

Interactions

View interactions

	KEGG		Reactome
	EGFR tyrosine kinase inhibitor resistance Chemokine signaling pathway HIF-1 signaling pathway FoxO signaling pathway Hormone signaling Necroptosis Signaling pathways regulating pluripotency of stem cells JAK-STAT signaling pathway Th17 cell differentiation Prolactin signaling pathway Adipocytokine signaling pathway Insulin resistance AGE-RAGE signaling pathway in diabetic complications Growth hormone synthesis, secretion and action Toxoplasmosis Hepatitis C Hepatitis B Measles Human cytomegalovirus infection Kaposi sarcoma-associated herpesvirus infection Epstein-Barr virus infection Coronavirus disease - COVID-19 Pathways in cancer Viral carcinogenesis Proteoglycans in cancer MicroRNAs in cancer Chemical carcinogenesis - receptor activation Pancreatic cancer Acute myeloid leukemia Non-small cell lung cancer PD-L1 expression and PD-1 checkpoint pathway in cancer Inflammatory bowel disease Lipid and atherosclerosis		Interleukin-6 signaling BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members Interleukin-7 signaling Signaling by SCF-KIT Signaling by cytosolic FGFR1 fusion mutants Downstream signal transduction Senescence-Associated Secretory Phenotype (SASP) POU5F1 (OCT4), SOX2, NANOG activate genes related to proliferation Transcriptional regulation of pluripotent stem cells Interleukin-10 signaling Interleukin-4 and Interleukin-13 signaling PTK6 Activates STAT3 Interleukin-20 family signaling MET activates STAT3 Interleukin-15 signaling Interleukin-35 Signalling Interleukin-9 signaling Interleukin-37 signaling Interleukin-23 signaling Interleukin-27 signaling Interleukin-21 signaling Signaling by PDGFRA transmembrane, juxtamembrane and kinase domain mutants Signaling by PDGFRA extracellular domain mutants

1274

Show/Hide Causal Diseases (7)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Hyper-IgE recurrent infection syndrome 1, autosomal dominant	Likely pathogenic; Pathogenic	rs2144697778, rs2081903545, rs2144683205, rs2144773624, rs1567708034, rs2144622906, rs2144832509, rs2144778323, rs2144622987, rs2144683531, rs2144827923, rs2144683683, rs2509391311, rs2144691401, rs2509118228 View all (38 more)	RCV001594427 RCV001343329 RCV001378695 RCV001378195 RCV001380075 RCV001823640 RCV001995210 RCV001912793 RCV001967161 RCV001950022 RCV003096208 RCV002284058 RCV002469940 RCV002469941 RCV003041301 RCV003041304 RCV003041305 RCV003050468 RCV003064439 RCV003050469 RCV003084909 RCV002635401 RCV002975063 RCV003021538 RCV000653278 RCV001302951 RCV000653281 RCV003142263 RCV000792133 RCV003783708 RCV003783710 RCV003797364 RCV000019965 RCV000019966 RCV000019967 RCV000019968 RCV000019969 RCV000019970 RCV004547343 RCV002521588 RCV001216892 RCV003987557 RCV003139697 RCV000695153 RCV000605582 RCV005222989 RCV000811844 RCV000030463 RCV000030464 RCV000030469 RCV000030470 RCV000030471 RCV000556500 RCV000585688 RCV000822142 RCV000054835 RCV000989849 RCV001054381 RCV001220202 RCV001302950
Hyper-IgE syndrome	Likely pathogenic; Pathogenic	rs886039434, rs113994139	RCV000586892 RCV000587895
Inherited Immunodeficiency Diseases	Pathogenic; Likely pathogenic	rs113994136, rs1064794957	RCV001027632 RCV001027630
See cases	Pathogenic	rs869312892	RCV005893842
STAT3 gain of function	Pathogenic; Likely pathogenic	rs2081903545, rs2144683205, rs2144773624, rs1567708034, rs2144832509, rs2144778323, rs2144622987, rs2144683531, rs2144827923, rs2509118228, rs113994139, rs2144683812, rs2144691170, rs2144691319, rs2144682791 View all (25 more)	RCV001343329 RCV001378695 RCV001378195 RCV001380075 RCV001995210 RCV001912793 RCV001967161 RCV001950022 RCV003096208 RCV003041301 RCV003041304 RCV003041305 RCV003050468 RCV003064439 RCV003050469 RCV003084909 RCV002635401 RCV002975063 RCV003021538 RCV000653278 RCV001302951 RCV000653281 RCV000792133 RCV003783708 RCV003783710 RCV003797364 RCV001851955 RCV000814004 RCV001059385 RCV003764611 RCV000653282 RCV002521588 RCV001216892 RCV000695153 RCV005222989 RCV000811844 RCV000536459 RCV005222709 RCV000792130 RCV000556500 RCV001860114 RCV000822142 RCV001054381 RCV001220202 RCV001302950
STAT3-related disorder	Likely pathogenic; Pathogenic	rs869312888, rs2509390675, rs1064794957	RCV004545762 RCV003418921 RCV003401539
STAT3-related early-onset multisystem autoimmune disease	Pathogenic; Likely pathogenic	rs587777648, rs587777649, rs587777650, rs869312892, rs869312894, rs869312889, rs869312888, rs869312893, rs869312891, rs869312887, rs869312890, rs113994135, rs113994137, rs1064794957, rs193922717, rs2081520204, rs2081712040 View all (2 more)	RCV000133537 RCV000133538 RCV000133539 RCV000210415 RCV000210433 RCV000210428 RCV000210420 RCV000210425 RCV000210422 RCV000210413 RCV000210417 RCV003149573 RCV001333533 RCV002063763 RCV000210430 RCV001267795 RCV001253455 RCV001254616

Show/Hide Unknown Diseases (17)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Adenoid cystic carcinoma	-	rs1555564365	RCV004813297
Cervical cancer	Likely benign; Benign	rs114401618, rs17882035	RCV005915061 RCV005888808
Cholangiocarcinoma	Benign	rs8081431	RCV005905382
EBV-Positive Inflammatory Follicular Dendritic Cell Sarcoma	Conflicting classifications of pathogenicity	rs2081548277	RCV003320250
EBV-positive nodal T- and NK-cell lymphoma	Conflicting classifications of pathogenicity; Uncertain significance	rs769031989, rs747639500	RCV004559046 RCV004559917
Hepatocellular carcinoma	Benign	rs8081431	RCV005905380
Lung cancer	Benign; Likely benign	rs17882035, rs146620441	RCV005888811 RCV005900382
Malignant lymphoma, large B-cell, diffuse	Conflicting classifications of pathogenicity; Benign; Likely benign	rs769031989, rs62075768, rs8081431	RCV003448978 RCV005905375 RCV005905381
Malignant tumor of esophagus	Likely benign	rs114401618	RCV005915060
Neoplasm	Uncertain significance; Conflicting classifications of pathogenicity	rs886039546, rs769031989, rs747639500	RCV006274242 RCV004668912 RCV004671241
Nonpapillary renal cell carcinoma	Conflicting classifications of pathogenicity	rs2144622620	RCV005919156
Ovarian serous cystadenocarcinoma	Conflicting classifications of pathogenicity	rs1567713850	RCV005897396
Sarcoma	Benign	rs17882035	RCV005888809
Squamous cell carcinoma of the head and neck	Benign	rs17882035	RCV005888807
Thymoma	Benign	rs17882035	RCV005888810
Uterine carcinosarcoma	Benign; Likely benign	rs62075768	RCV005905376
Uterine corpus endometrial carcinoma	Benign	rs17882035	RCV005888812

Show/Hide Text Mining Associations (607)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abortion Spontaneous	Associate	26969967
Abscess	Associate	33717144
Acidosis	Stimulate	35927628
Acquired Immunodeficiency Syndrome	Associate	18024124
Acrocephalosyndactylia	Associate	23726368
Acute Disease	Associate	25663681, 36688918
Acute Kidney Injury	Associate	33505213
Acute Lung Injury	Associate	37864659
Adenocarcinoma	Associate	18320073, 29890775, 29991802, 31085800, 31291201, 32869704
Adenocarcinoma	Stimulate	36225196
Adenocarcinoma Follicular	Associate	35769818
Adenocarcinoma of Lung	Associate	18167335, 21122157, 21546410, 25763322, 26840709, 27486982, 27846317, 28574510, 30099826, 30747209, 32187953, 32515474, 32686362, 32705271, 33426073 View all (8 more)
Adenoma	Associate	16049285, 18320073, 21166956
Adenoma Liver Cell	Associate	21690253, 24612692
Adenoma Pleomorphic	Associate	26790448, 27286739
Adenomatous Polyposis Coli	Associate	24073274
Adenomyosis	Associate	30687738
Adrenoleukodystrophy	Associate	40004040
Agammaglobulinemia	Associate	25349174, 31068927, 33519826, 34875609
Airway Remodeling	Associate	34939316
Allergic Fungal Sinusitis	Associate	31379870
Alopecia Neurologic Defects and Endocrinopathy Syndrome	Associate	30942636, 37390899
Alveolar Bone Loss	Associate	37697911
Alzheimer Disease	Associate	28803389, 29848990, 30185668, 31346092, 32580970, 34804058
Alzheimer Disease	Inhibit	29907690
Alzheimer Disease	Stimulate	34837964
Anemia Aplastic	Associate	23926297, 25359994, 33586472, 33785863
Anemia Diamond Blackfan	Associate	29745857
Anemia Hemolytic	Associate	33519826
Anemia Hemolytic Autoimmune	Associate	33519826
Anemia Refractory with Excess of Blasts	Stimulate	11027834
Aneurysm	Associate	21494893
Angina Stable	Associate	19204206
Anodontia	Stimulate	39778225
Anophthalmia with pulmonary hypoplasia	Associate	23094050
Anorexia Nervosa	Associate	35703085
Anthropophobia	Associate	33048872, 37364375
Aortic Aneurysm Abdominal	Associate	21764069, 31868202
Apical Hypertrophic Cardiomyopathy	Associate	37567042
Arthritis	Associate	22802946, 28634854, 37771106
Arthritis Experimental	Associate	37771106
Arthritis Juvenile	Associate	29848367, 31641939
Arthritis Psoriatic	Associate	16622521, 28052368, 35087513
Arthritis Rheumatoid	Associate	15535835, 22532634, 22736089, 22736176, 23308194, 23421940, 24082147, 24708416, 25164131, 25430993, 25436214, 25649145, 25880754, 26308397, 27629845 View all (26 more)
Arthritis Rheumatoid	Stimulate	35706043
Ascites	Associate	20860602, 27825119, 32390009
Aspergillosis	Associate	32047500
Aspergillus meningitis	Associate	32047500
Asthma	Associate	15935090, 18310224, 20093796, 30864351, 32308108, 32512817, 40594490
Asthma	Stimulate	28295786, 39326916
Astrocytoma	Associate	13678425, 19088040, 22231733, 24386409, 25246098, 33448156, 34169995
Astrocytoma	Stimulate	20052595
Ataxia Telangiectasia	Associate	22859607, 31958078, 37126127, 40309770
Atherosclerosis	Associate	21494893, 32626987
Atrial Fibrillation	Associate	35003319
Atrial myxoma familial	Associate	37452081
Atrial Remodeling	Associate	25219839
Autoimmune Diseases	Associate	16331268, 20159113, 25038750, 25349174, 25359994, 26343524, 29378236, 30337298, 30886421, 30942636, 34654687, 34875609, 35188103, 35677041, 35810312, 36544766, 38184662, 40243893 View all (3 more)
Autoimmune enteropathy	Associate	30942636, 37390899
Autoimmune Lymphoproliferative Syndrome	Associate	25174872, 34183838, 34721429, 34875609, 35058929
Axial Spondyloarthritis	Associate	26671920
Barrett Esophagus	Associate	21127259, 21148399, 22744336, 29991802
Basal cell carcinoma multiple	Associate	29133756
Behcet Syndrome	Associate	25410656, 27922688
Bile Reflux	Associate	34850540
Blister	Associate	23623265
Bone Diseases	Associate	16331882, 22802946
Bone Diseases Metabolic	Associate	26390436, 36605204
Bone Marrow Failure Disorders	Associate	23926297, 30337298
Brachydactyly Type D	Stimulate	28504607
Brain Diseases	Associate	35461327, 36329890
Brain Edema	Associate	25337261
Brain Ischemia	Associate	23666460
Brain Neoplasms	Associate	25246098, 26283544, 35732500, 36780531
Breast Neoplasms	Associate	11113455, 11859072, 15781862, 16288304, 16710719, 16877361, 17344214, 17531096, 17597020, 17922140, 19372587, 19491198, 20164027, 20830236, 20929863 View all (119 more)
Breast Neoplasms	Stimulate	21325207, 23938089, 28099147, 38441231
Breast Neoplasms Male	Associate	30850364
Bronchiectasis	Associate	31068927, 36605204
Bronchiolitis	Inhibit	31780735
Bronchiolitis	Associate	33804639
Burkitt Lymphoma	Associate	22967991, 25717101, 30194286
Cakut	Associate	39734345
Calcinosis	Associate	31461977, 33173427
Calcinosis Cutis	Associate	27223432, 36780531
Calcium Metabolism Disorders	Associate	30024306
Candidiasis	Associate	23623265
Candidiasis Chronic Mucocutaneous	Associate	23796786, 36605204
Carcinogenesis	Associate	11819729, 12015764, 15184909, 16049285, 16170336, 17360477, 17438134, 17438334, 20012909, 20068065, 20977777, 21174186, 21538419, 21575192, 21690253 View all (65 more)
Carcinogenesis	Stimulate	15781862, 19658181
Carcinoma	Associate	36509291
Carcinoma Adenoid Cystic	Associate	26367487, 26790448
Carcinoma Basal Cell	Associate	12445202, 15610530, 31342143, 31870221
Carcinoma Basal Cell	Stimulate	35552660
Carcinoma Ductal Breast	Associate	29137038
Carcinoma Endometrioid	Associate	28937296
Carcinoma Hepatocellular	Associate	11257503, 15354212, 16901975, 18651980, 19140229, 20712901, 21198544, 22408571, 23391762, 23533997, 23620780, 23756865, 24376686, 24912675, 24980149 View all (93 more)
Carcinoma Hepatocellular	Inhibit	28732507
Carcinoma Hepatocellular	Stimulate	29133756, 29556041
Carcinoma in Situ	Associate	32281236
Carcinoma Intraductal Noninfiltrating	Associate	26146825
Carcinoma Large Cell	Associate	24382554
Carcinoma Merkel Cell	Associate	27592799
Carcinoma Mucoepidermoid	Inhibit	26790448
Carcinoma Mucoepidermoid	Associate	29363716
Carcinoma Non Small Cell Lung	Associate	15894558, 17824789, 19265129, 19569236, 20052735, 21948749, 22319590, 22330135, 22467101, 22723956, 23244248, 23894143, 24117170, 24274066, 24312384 View all (49 more)
Carcinoma Ovarian Epithelial	Associate	20860602, 26264211, 26657115, 26801672, 27825119, 28560454, 28859117, 32239647, 36814597
Carcinoma Pancreatic Ductal	Associate	18254976, 24520077, 28121485, 31533831, 34771150, 36495330, 39684873
Carcinoma Renal Cell	Associate	18787400, 19574718, 22899991, 24606948, 24615012, 25031744, 25388155, 26797799, 27089226, 27223432, 27712594, 28453463, 29286132, 31636361, 32640276 View all (11 more)
Carcinoma Small Cell	Stimulate	22938476
Carcinoma Squamous Cell	Stimulate	17110342, 28972958
Carcinoma Squamous Cell	Associate	19070595, 19616333, 19638983, 20228845, 20682796, 23959540, 24191246, 24382554, 25573684, 25854367, 27457246, 28423512, 32161621, 32281236, 32483193, 34195851, 36005200 View all (2 more)
Carcinoma Squamous Cell	Inhibit	24833526
Carcinoma Transitional Cell	Associate	26156799
Cardiomyopathies	Associate	39294340
Cardiomyopathy Hypertrophic	Associate	30338905, 33558530
CD59 Deficiency	Associate	28564606, 31732533
Celiac Disease	Associate	22785229, 26859134
Cell Transformation Neoplastic	Associate	21258401, 31173474, 31487312, 31568628, 31863907, 32945237
Cell Transformation Neoplastic	Inhibit	40636126
Cerebral Hemorrhage	Associate	37552127
Cerebral Infarction	Associate	32960689
Chemical and Drug Induced Liver Injury	Associate	32054011
Cholangiocarcinoma	Associate	16790433, 17241887, 23295441, 24998588, 26296968, 26743134, 27206490, 30880773, 32252311, 33038372, 34697068, 34758510, 34837926, 35683032, 35790790
Cholangiocarcinoma	Stimulate	28032598
Cholangitis Sclerosing	Associate	37256725
Cholelithiasis	Associate	40536380
Cholestasis	Associate	34737337
Cholesteatoma	Associate	19672202, 24551293
Cholesteatoma Middle Ear	Associate	24551293
Chondrosarcoma	Associate	30790501
Chordoma	Associate	39393273
Choriocarcinoma	Associate	29215740
Chromosome 7 monosomy	Associate	16980411
Chromosome Aberrations	Associate	23926297
Chronic Disease	Associate	17376889, 24082147
Chronic Pain	Associate	32717400
Cicatrix	Associate	33662027
Clear cell metastatic renal cell carcinoma	Associate	27089226, 28381801
Colitis	Associate	22021169
Colitis Associated Neoplasms	Associate	22021169
Colitis Ulcerative	Associate	21530736, 22467146, 24781989, 27852544, 30369485, 31918598, 35946880
Colitis Ulcerative	Stimulate	36857861
Colonic Diseases	Associate	35655107
Colonic Neoplasms	Associate	10570189, 16049285, 16192633, 17438334, 19476491, 21486470, 22423663, 25110240, 27573444, 30679726
Colorectal Neoplasms	Associate	15162527, 16192633, 16455651, 17264243, 17360477, 17922140, 18200666, 18320073, 20065946, 20196786, 20534983, 20712901, 20970032, 21486470, 21994466 View all (98 more)
Colorectal Neoplasms	Stimulate	21310826, 24116229
Colorectal Neoplasms	Inhibit	32486001
Common Variable Immunodeficiency	Associate	32047491, 34875609, 35990641
Communicable Diseases	Associate	20093388
Complement Component 6 Deficiency	Associate	23907460
Complex Regional Pain Syndromes	Associate	24244504
Congenital Abnormalities	Associate	29378236
Congenital disorder of glycosylation type 1L	Associate	32207811
Congenital Hyperinsulinism	Associate	29955086
Connective Tissue Diseases	Associate	21494893
Coronary Aneurysm	Associate	21494893
Coronary Artery Disease	Associate	24736319, 26936111, 27596284, 33632325
Coronary Disease	Associate	40184077
Coronavirus Infections	Associate	25534508
COVID 19	Associate	32344305, 32783921, 32949179, 33138195, 33832550, 33833618, 33991637, 34322810, 34626364, 34757528, 34941025, 35301248, 35366469, 35464051, 35718334 View all (4 more)
COVID 19	Stimulate	33422363, 34193364, 37307689, 37699145
Coxa Magna	Associate	35190765
Craniocerebral Trauma	Associate	27173233
Crohn Disease	Associate	20159113, 21152001, 21548950, 22197944, 22467146, 23950992, 24885273, 26278503, 27852544, 29556615, 31191543, 31321245, 34749666, 37175705
Crohn Disease	Stimulate	21228771, 28729389
Cryptococcosis	Associate	35720334
Cushing Syndrome	Associate	36316863
Cystic Fibrosis	Associate	21731057, 22069317, 36048831, 36480571
Cystitis Interstitial	Associate	39399486
Cysts	Associate	23573315, 33112055
Cytokine Release Syndrome	Stimulate	33422363
Deafness Autosomal Recessive 53	Associate	33925065
Death	Associate	20371693, 25973100, 32248557, 33717144
Death	Inhibit	25973100
deficiency of adenosine deaminase 2	Associate	34721429
Dendritic Cell Sarcoma Follicular	Associate	25349174, 28350008
Depressive Disorder	Associate	32998701, 37745719
Dermatitis Atopic	Associate	27498343, 35651609, 37540585, 40713851
Dermatitis Atopic 1	Associate	27498343
Dermatomyositis	Associate	27803134
Diabetes Gestational	Associate	33890634
Diabetes Mellitus	Stimulate	26743134
Diabetes Mellitus	Associate	28402852, 29417186, 30478982, 33731004, 35504843, 36496541
Diabetes Mellitus Transient Neonatal 1	Associate	28402852
Diabetes Mellitus Type 1	Associate	25038750, 27629486, 31949260
Diabetes Mellitus Type 2	Associate	23110196, 32041280, 33833859, 36037214, 37680885, 40080435
Diabetic Cardiomyopathies	Associate	34418601, 34926700
Diabetic Foot	Associate	35394091
Diabetic Nephropathies	Associate	33279869
Diabetic Retinopathy	Associate	33563844
Diarrhea	Associate	28623282
Disease	Associate	19204206, 20565793, 22532634, 27803134, 29848367, 33579790, 40496858
Disease Resistance	Associate	28656316, 28864784
Drug Related Side Effects and Adverse Reactions	Associate	22116549, 22986230, 26340617, 26875492, 27367272, 29476109, 30554487, 33123602, 33650331, 35956786, 36982155, 40027184
Drug Resistant Epilepsy	Associate	28623282
Dykes Markes Harper syndrome	Associate	34875609
Dysbiosis	Associate	30185668
Dyskinesias	Associate	12454768
Dyslipidemias	Associate	28316372
Ectodermal Dysplasia	Associate	35341013
Eczema	Associate	33717144
Elejalde Disease	Associate	30403186
End Stage Liver Disease	Associate	12547716
Endocrine System Diseases	Stimulate	36266450
Endometrial Neoplasms	Associate	19154413, 28112250, 31298317, 34153644
Endometriosis	Associate	25950905, 33893391, 35279667
Endometriosis	Stimulate	37095705
Enteropathy Associated T Cell Lymphoma	Associate	33579790
Eosinophilic enteropathy	Associate	40243893
Eosinophilic Esophagitis	Associate	35126392, 37652141, 40243893
Ependymoma	Associate	25968456
Epidermolysis bullosa with pyloric atresia	Associate	28709401
Epilepsy	Associate	32016989, 36825472
Epstein Barr Virus Infections	Stimulate	12634372, 16611410, 24639502
Epstein Barr Virus Infections	Associate	31311407, 32273478, 32273550, 32961552, 33002095, 33297669, 35021606, 35341013
Esophageal Neoplasms	Associate	26553224, 34036398, 35264069, 35780460, 35856449, 36226375, 37500660
Esophageal Squamous Cell Carcinoma	Associate	25355139, 25550842, 26370982, 26553224, 28459198, 29767234, 30468470, 31081089, 31298412, 32071920, 32374927, 33330321, 34218518, 34520294, 35428295, 37752569 View all (1 more)
Evans Syndrome	Associate	30940614, 35655776
Facial Dysmorphism with Multiple Malformations	Associate	33717144
Familial Primary Pulmonary Hypertension	Associate	17526595
Fasciitis	Associate	34381187
Fatty Liver	Associate	29615085
Felty Syndrome	Associate	29217783, 33280072, 37497725
Fever	Inhibit	38350654
Fibrocartilaginous embolism	Associate	34321087
Fibrosarcoma	Associate	15883164
Fibrosis	Associate	17318196, 19140229, 25477471, 29133756, 33558530, 35792886
Fibrosis	Inhibit	22527947
Fibular hypoplasia and complex brachydactyly	Associate	36977736
Focal Cortical Dysplasia	Stimulate	29162878
Fractures Bone	Associate	20159255, 22802946, 33717144
Fuchs' Endothelial Dystrophy	Stimulate	32636303
Fused Kidney	Associate	37846594
Gallbladder Neoplasms	Associate	28061445, 30086773
Gallbladder Neoplasms	Stimulate	40536380
Gastritis Atrophic	Associate	27173233
Gastrointestinal Diseases	Associate	28803389
GATA2 Deficiency	Associate	24350896, 25612622, 26727971, 28284718, 30054295, 31311407, 32321919
Genetic Diseases Inborn	Associate	24797340, 33519826, 34875609, 35655776
Glioblastoma	Associate	13678425, 18487947, 18524891, 19658181, 20371721, 20488164, 20667896, 20712901, 21073634, 21385897, 21526200, 21906308, 22532597, 22709411, 23096132 View all (56 more)
Glioblastoma	Stimulate	39487455
Glioma	Associate	15184909, 16319070, 18487947, 19088040, 19658181, 21655185, 21900396, 21906308, 22843679, 22957741, 23907460, 23936533, 24048798, 24913705, 24945373 View all (36 more)
Glomerulonephritis	Associate	33043579
Glomerulonephritis IGA	Associate	33462083, 33874912, 34861820
Glomerulonephritis Membranous	Associate	35172688
Glomerulosclerosis Focal Segmental	Stimulate	36374911
Glut1 Deficiency Syndrome	Associate	33321923
Graft vs Host Disease	Stimulate	26327693
Graft vs Host Disease	Associate	26555814, 30280423
Granuloma	Associate	19915152
Graves Disease	Associate	24081513, 35008579
Graves Ophthalmopathy	Associate	24081513, 35008579
Growth Disorders	Inhibit	16884491
Growth Disorders	Associate	25359994, 29378236, 33519826
Growth Hormone Secreting Pituitary Adenoma	Associate	31165412
HAIR AN syndrome	Associate	23110196
Hashimoto Disease	Associate	20558345, 24081513, 32662826
Head and Neck Neoplasms	Associate	12454768, 12640143, 18316548, 24019973, 24395800, 26209830, 27181202, 27855189, 34850540
Heart Diseases	Associate	20022263, 25720718, 37018396
Heart Failure	Inhibit	25720718
Heart Failure	Associate	35645616, 37018396
Helicobacter Infections	Associate	32729225
Hematologic Diseases	Associate	24618699, 25359994, 33519826, 36544766
Hematologic Neoplasms	Associate	22319590, 25912076, 28208828, 34874980
Hepatic Encephalopathy	Associate	26757951
Hepatitis B	Associate	23483208, 29207087, 29609539, 32228643
Hepatitis B Chronic	Associate	26163643, 26745093, 29609539
Hepatitis C	Associate	15650183, 28159835, 33785040
Hepatitis C	Stimulate	22951829
Hepatitis C Chronic	Associate	32507013
Hereditary Breast and Ovarian Cancer Syndrome	Associate	18587580, 21788134, 28159925, 30206415, 33331925, 33367520, 33660353
Hereditary leiomyomatosis and renal cell cancer	Associate	18684866, 24633193
Hereditary Myopathy with Early Respiratory Failure	Associate	34875609
Herpes Zoster	Associate	34322810
Hippocampal Sclerosis	Associate	29162878
HIV Infections	Associate	16045742, 25613134, 32053234, 38037074
HIV Infections	Inhibit	26501424
Hodgkin Disease	Associate	11222718, 11468177, 11781246, 12393683, 18684866, 21418178, 24633193, 29650799, 36751942
HTLV I Infections	Associate	23278479
Huntington Disease	Associate	25430993, 29328442
Hydroa Vacciniforme	Associate	32682634
Hyperglycemia	Associate	33038372
Hyperplasia	Associate	29630659, 37309689
Hypertension	Associate	30864351, 36473131
Hypertension	Stimulate	35676631
Hypertriglyceridemia	Associate	25014397
Hypertrophy	Associate	16920889, 35406794
Hyperuricemia	Associate	34716863
Hypomagnesemia 5 Renal with Ocular Involvement	Associate	36640055
Hypoxia	Stimulate	19265129, 20153296, 21731766, 21911602, 23756865, 26078356, 32945388, 33029691
Hypoxia	Associate	24002598, 27163161, 28257048, 29459227, 29518129, 29693186, 32345623, 33484391, 36082356, 36814597, 37752569
Hypoxia	Inhibit	27558590, 33123602
Hypoxia Brain	Stimulate	19265129, 22004076
Hypoxia Brain	Associate	30090015, 32823915
Idiopathic Noncirrhotic Portal Hypertension	Associate	25899133, 34737337
Idiopathic Pulmonary Fibrosis	Associate	30481203
IgA Vasculitis	Associate	22736176, 23968543, 38565387
Immune Dysregulation Polyendocrinopathy Enteropathy X Linked Syndrome	Associate	25349174, 33864888
Immune System Diseases	Associate	22271514, 23704931, 29378236, 31707214, 34653276, 35058929, 35587532, 35655107, 37090709, 37325673, 40309770
Immunologic Deficiency Syndromes	Associate	18841165, 24159173, 25359994, 30942636, 33717144
Infections	Inhibit	11673534
Infections	Associate	21494893, 23623265, 31487312, 33193365, 35655107
Infections	Stimulate	24581222, 32418990
Infertility Male	Associate	35810312
Inflammation	Associate	15935090, 16946298, 17438334, 17543278, 18069684, 18700015, 19088040, 21127259, 21148399, 21310826, 21339300, 21430300, 21506956, 21625522, 21737619 View all (135 more)
Inflammation	Stimulate	17364491, 23295441, 37709251, 38325586
Inflammation	Inhibit	23096132
Inflammatory Bowel Diseases	Associate	18069684, 19068216, 21088407, 21530736, 22197944, 25132422, 26278503, 27852544, 28770550, 29182760, 29228965, 31732533, 36437465, 37600767
Insulin Like Growth Factor I Resistance To	Associate	29378236
Insulin Resistance	Associate	17636079, 17993646, 25747354, 29955086, 31396538
Interleukin 2 Receptor Alpha Deficiency of	Associate	25359994
Intervertebral Disc Degeneration	Associate	26587789, 36081453, 38041088, 40426248
Intracranial Aneurysm	Associate	32804311, 35833148
Intrahepatic Cholestasis of Pregnancy	Associate	35643225
Invasive Pneumococcal Disease Recurrent Isolated 2	Associate	25349174
Iron Overload	Associate	31628297
Ischemia	Associate	30024306
Job Syndrome	Associate	17881745, 18591410, 18591412, 18602572, 18841165, 19577286, 19891924, 20004785, 20093388, 20159255, 20490271, 21288777, 21300911, 21346738, 21426892 View all (48 more)
Kabuki syndrome	Associate	35058929
Keloid	Associate	33662027
Keratosis Actinic	Associate	27457246
Kidney Diseases	Associate	23573315, 34884542, 36640055, 39734345
Kidney Diseases Cystic	Associate	23573315
Kidney Neoplasms	Associate	11849447, 29272308, 36246395, 39480959
Laron Syndrome	Associate	29378236
Laryngeal Neoplasms	Associate	25605256, 26318305, 27181202, 30893785, 31189744
Lead Poisoning Nervous System	Associate	35151246, 37567042
Leiomyoma	Associate	35598777, 36771423
Lentigo	Associate	25917897
Leukemia	Associate	11369651, 21756540, 21887305, 23515927, 25359994, 25383546, 27576506, 28596283, 31409670, 32252439, 32409689, 34967577, 9657745
Leukemia B Cell	Associate	18160665, 27737889, 27799566
Leukemia Biphenotypic Acute	Associate	25193702
Leukemia Large Granular Lymphocytic	Associate	11160159, 22591296, 22859607, 23515927, 23596048, 23926297, 24283217, 24350896, 24618699, 24797340, 25281507, 25349174, 27542218, 28633612, 29148541 View all (17 more)
Leukemia Lymphocytic Chronic B Cell	Associate	16517754, 18941194, 19228728, 20154216, 20159608, 20686606, 21220745, 21364020, 21398617, 21486864, 21733558, 23725032, 24883303, 27074565, 27076684 View all (12 more)
Leukemia Lymphocytic Chronic B Cell	Stimulate	24836891, 25733697
Leukemia Lymphoma Adult T Cell	Associate	16603085, 28910419, 29084771, 30231940, 31237072, 32196559, 34661140, 36842846, 9391124
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	20065083, 21887305, 24870597, 24969884, 25041018, 25134459, 25417721, 26942564, 28596283, 29936783, 37345979
Leukemia Myeloid	Associate	18483256, 21677772, 31546234
Leukemia Myeloid	Stimulate	23717691
Leukemia Myeloid Acute	Associate	10845908, 11756179, 17404111, 20035426, 21456022, 21756540, 23628554, 24283803, 24903009, 26466521, 31117333, 31406210, 31538427, 31842997, 32021103 View all (13 more)
Leukemia Myeloid Acute	Stimulate	11027834
Leukemia Plasma Cell	Associate	26722442, 35610009
Leukemia Prolymphocytic T Cell	Associate	27469405, 31974418
Leukemia Promyelocytic Acute	Associate	10622210
Leukemia T Cell	Associate	26728704
Leukemic Infiltration	Associate	37563649
Leydig Cell Tumor	Associate	38387140
Light Fixation Seizure Syndrome	Associate	33743629
Liposarcoma	Associate	30654529, 32998376, 35740967
Liver Cirrhosis	Associate	12547716, 17318196, 29133756, 37978263
Liver Cirrhosis Alcoholic	Associate	12547716
Liver Cirrhosis Biliary	Associate	25627620, 34737337
Liver Diseases	Associate	28159835, 29609539, 34737337
Liver Diseases Alcoholic	Associate	12547716
Liver Failure	Associate	31534132, 33155205, 34235224, 40536380
Liver Neoplasms	Associate	24912675
Lung Diseases	Associate	17526595, 29620631, 34875609, 36480571, 40462219
Lung Diseases Interstitial	Associate	31969166, 34875609, 35016744, 35677041, 37390899
Lung Injury	Associate	28713982, 35583012
Lung Neoplasms	Associate	14617776, 16648865, 19578748, 19903771, 21122157, 21497567, 21546410, 22723956, 22904633, 23244248, 23704931, 23820254, 24280348, 24382554, 24657910 View all (27 more)
Lung Neoplasms	Stimulate	31196220
Lupus Erythematosus Cutaneous	Associate	35258358
Lupus Erythematosus Systemic	Stimulate	17364491
Lupus Erythematosus Systemic	Associate	21635228, 25187566, 25339666, 26968426, 27351906, 28177455, 28940360, 30280423, 32768442, 35188103, 35592687, 38184662, 40594490
Lupus Nephritis	Inhibit	21635228
Lupus Nephritis	Associate	25339666
Lymphangioleiomyomatosis	Associate	19596836
Lymphatic Diseases	Associate	25359994, 30942636, 33519826, 34875609
Lymphatic Metastasis	Associate	16049285, 19638983, 21072904, 23382965, 23824569, 23824571, 25337233, 25405202, 26323925, 28448787, 29970682, 32187953, 33663040, 34165442
Lymphatic Metastasis	Stimulate	21577321, 27292026, 28032598, 29137038, 36225196
Lymphoma	Associate	18024124, 19088198, 21418178, 22116549, 23716548, 24581222, 25070240, 25586472, 26430964, 27564404, 28415725, 28496056, 29133756, 29228427, 29295936 View all (5 more)
Lymphoma B Cell	Associate	11781246, 18024124, 21418178, 23599149, 26430964, 33318172, 40243506
Lymphoma B Cell	Stimulate	24142927
Lymphoma Extranodal NK T Cell	Associate	25612622, 25980440, 31002364, 31822801
Lymphoma Follicular	Associate	23297127
Lymphoma Large B Cell Diffuse	Associate	17951530, 18160665, 21806788, 22116549, 22967991, 23018644, 23861822, 24142927, 24220563, 24581222, 24650281, 25124685, 25472725, 25760242, 25984943 View all (12 more)
Lymphoma Large B Cell Diffuse	Stimulate	32798587
Lymphoma Large Cell Anaplastic	Associate	15161657, 15858125, 16825495, 16939498, 18509351, 19608866, 20971814, 23975180, 25987255, 30093402, 30206415, 31383967, 33184494, 33660353, 35941721, 37388733 View all (1 more)
Lymphoma Mantle Cell	Associate	12472567, 16048411, 25216518, 27614429, 28529032, 30530749
Lymphoma Non Hodgkin	Associate	11781246, 18070987, 23768868, 35990641, 36193491
Lymphoma Primary Effusion	Associate	17151100, 23740979, 29179721, 36835344
Lymphoma T Cell	Associate	11751994, 16170336, 16861352, 24345752, 27275540, 28122867, 30020405, 30054295, 31049933, 31601188, 35014680, 35752777
Lymphoma T Cell Cutaneous	Associate	10485875, 11159537, 11807001, 20393484, 21346774, 25485578, 26244872, 26738536, 31049933, 31213131, 32270320, 33333886
Lymphoma T Cell Peripheral	Associate	30054295, 30420593, 30782609
Lymphoproliferative Disorders	Associate	22859607, 25281507, 31558678, 33512451, 34875609, 36441748
Macular Degeneration	Associate	25543336
Macular Edema	Associate	30942636
Mammary Neoplasms Animal	Associate	30042492
Meckel syndrome type 1	Associate	32406563
Medulloblastoma	Associate	18592012, 21526200, 25313399, 28035977, 29207075, 33279931, 34254873, 35159191
Medulloblastoma	Inhibit	21193839
Medulloblastoma	Stimulate	29280516
Melanoma	Associate	10072444, 11442760, 15564140, 16801397, 17384650, 18171991, 18305569, 18386001, 18596671, 19758315, 20576164, 21268068, 21853302, 21953023, 22046235 View all (33 more)
Melanoma	Stimulate	37481560
Melanoma Cutaneous Malignant	Stimulate	18596671
MELAS Syndrome	Associate	35715869
Meningeal Neoplasms	Associate	34691054
Meningioma	Associate	20052595
Mesothelioma Malignant	Associate	17824789, 27987139, 30259640, 35794237
Metabolic Diseases	Associate	25014397, 38387703
Metabolic Syndrome	Associate	19776189, 24358323
Microcystic adnexal carcinoma	Associate	31857679
Mouth Diseases	Associate	20977777, 37309689
Mouth Neoplasms	Associate	27742160, 28155253, 29516928, 29564744, 31251469, 32641093, 32961483, 33551310, 34318593, 34500779, 36231010, 39237001
Multi centric Castleman's Disease	Associate	23740979
Multiple Myeloma	Associate	11429412, 11986233, 12384432, 12707028, 12969979, 14726660, 14975242, 15354212, 15827128, 15860671, 15970928, 16123214, 17003370, 17164350, 17496199 View all (48 more)
Multiple Myeloma	Stimulate	24340030, 24407159
Multiple Sclerosis	Associate	18200504, 20159113, 30463275, 31004050, 31484947, 32241259, 33375941, 34874980, 36282535, 36441748, 37572949
Multiple Trauma	Associate	26343524, 40446056
Muscular Diseases	Associate	21436461
Muscular Dystrophy Duchenne	Associate	36814107
Musculoskeletal Abnormalities	Associate	32207811
Mycobacterium Infections Nontuberculous	Associate	25543043
Mycoses	Associate	23796786, 30185668, 32047500
Mycosis Fungoides	Associate	24621498, 31049933, 9192639
Myelodysplastic Syndromes	Associate	22753872, 23926297, 25359994, 31406210
Myocardial Infarction	Associate	31269974, 37798364, 39261934
Myotonic Dystrophy	Associate	22761857
Nasal Polyps	Associate	34653793
Nasopharyngeal Carcinoma	Associate	11222718, 12634372, 12865928, 22504904, 23382914, 24499623, 24966947, 25607111, 29685955, 29738439, 29914005, 30720169, 30849642, 31545261, 32083569 View all (10 more)
Nasopharyngeal Neoplasms	Associate	24966947, 29290793
Necrosis	Associate	27769057
Neointima	Associate	24768588
Neoplasm Metastasis	Stimulate	15162527, 22488042
Neoplasm Metastasis	Associate	17459060, 17824789, 19484134, 19578748, 20482858, 21490133, 22140473, 23066027, 23333300, 23590999, 23820254, 24170218, 24696730, 25063062, 25213863 View all (69 more)
Neoplasm Micrometastasis	Associate	29575778
Neoplasms	Associate	11222718, 11418694, 11807001, 12105218, 12393683, 12640143, 12865928, 13678425, 15063116, 15162527, 15781862, 16049285, 16219639, 16331268, 16648865 View all (464 more)
Neoplasms	Stimulate	17824789, 19718269, 21526200, 29292163, 31278347, 31427441, 37264956, 37709737, 38245869, 38441231
Neoplasms	Inhibit	18524891, 24274066, 28350008, 33725911
Neoplasms Glandular and Epithelial	Associate	19020503, 36535331
Neoplasms Squamous Cell	Associate	26379152, 32329845, 37950670
Neoplasms Vascular Tissue	Associate	28415725, 37978263
Neoplastic Cells Circulating	Associate	26671736
Nephrosis Lipoid	Associate	21426892
Nerve Compression Syndromes	Stimulate	32717400
Nerve Degeneration	Associate	35987203
Neuroblastoma	Associate	15606754, 19946221, 20490331, 22192458, 23633489, 39356934
Neurodegenerative Diseases	Associate	24945434, 35810312
Neurofibrosarcoma	Associate	25833823
Neuroinflammatory Diseases	Associate	36306116, 36674945, 37552127
Neutropenia	Associate	24283217, 31467122, 35676278, 37497725
Nevus	Associate	18305569
Nevus Pigmented	Associate	18596671
Non alcoholic Fatty Liver Disease	Stimulate	25747354
Non alcoholic Fatty Liver Disease	Associate	36473131, 37861538
Obesity	Associate	17636079, 19717488, 19776189, 21147860, 23110196, 23900445, 24558408, 25014397, 27768648, 37671970, 37878496, 38387703
Obesity	Inhibit	25747354
Obesity	Stimulate	29737494
Obesity Abdominal	Associate	19776189
Oculocutaneous albinism type 2	Stimulate	23250732
Oncogene Addiction	Associate	12105218, 18498667
Organizing Pneumonia	Associate	33731004, 35677041
Organizing Pneumonia	Stimulate	35676631
Ossification Heterotopic	Associate	35065610
Ossification of Posterior Longitudinal Ligament	Associate	17702747
Osteoarthritis	Associate	30551507, 30583016, 31875669, 33297736, 34669172, 37309689, 37788787, 39879889
Osteoarthritis Knee	Stimulate	21538317
Osteoporosis	Associate	22802946, 35758378, 36316863, 37335694
Osteosarcoma	Associate	17598902, 20063378, 20459702, 24455684, 25146150, 27735939, 28837148, 29048621, 30381753, 31081055, 31539114, 32775413, 33277868, 33828027, 34922636 View all (6 more)
Osteosarcoma	Stimulate	37774081
Ovarian Neoplasms	Associate	18587580, 19088723, 20606733, 21643014, 22801507, 24662131, 24799285, 24842412, 25896424, 25923701, 26894601, 27456942, 27590741, 28448787, 28536310 View all (28 more)
Pain	Associate	32717400
Pancreatic Neoplasms	Associate	15851011, 17054436, 17459060, 18566225, 19010822, 19673016, 20197401, 20482858, 21174186, 21573184, 21737619, 22348037, 23094050, 23206899, 23514705 View all (28 more)
Pancreatitis	Associate	26215634, 27333990
Pancytopenia	Associate	33731004
Papilledema	Associate	30942636
Papillomavirus Infections	Associate	20977777, 23874455
Paracoccidioidomycosis	Associate	31572394
Parkinson Disease	Associate	34536521, 36306116
Pdgfra Associated Chronic Eosinophilic Leukemia	Associate	22523564
pediatric multisystem inflammatory disease COVID 19 related	Associate	34193364
Pediatric Obesity	Associate	34471635
Periodontal Diseases	Associate	39337647
Periodontitis	Associate	37697911
Periodontitis	Stimulate	37697911
Peripheral Arterial Occlusive Disease 1	Associate	32481342
Peritonitis	Associate	23382965, 31690341, 36632455
Persistent Mullerian duct syndrome	Associate	40243506
Personality Disorders	Associate	25750173, 31418417, 33038372, 34372858
Phenylketonurias	Associate	29358461
Philadelphia Chromosome	Associate	38172124
Pituitary Neoplasms	Associate	28709401, 30609812
Plasmablastic Lymphoma	Associate	32273478, 33225311, 33951889, 34714908
Pneumonia	Associate	33717144
Polycystic Kidney Autosomal Recessive	Associate	33112055
Polycystic Kidney Diseases	Associate	27491076
Polycystic Ovary Syndrome	Associate	31115532, 35758378
Polycythemia Vera	Associate	26491227
Post Acute COVID 19 Syndrome	Associate	26769301
Pre Eclampsia	Associate	32572896
Precancerous Conditions	Stimulate	24434654
Precancerous Conditions	Associate	29190807, 31233202, 37713813
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	31943135, 35805156
Premature Birth	Associate	32733162
Primary Graft Dysfunction	Associate	30024306
Primary Immunodeficiency Diseases	Associate	25502423, 26162572, 30940614, 31969166, 33519826, 38644452
Primary Myelofibrosis	Associate	23386690, 31369569
Primary Ovarian Insufficiency	Associate	36434569
Prostate Cancer Hereditary 7	Associate	33511206
Prostatic Neoplasms	Associate	11733366, 11751884, 16804520, 17148681, 17438134, 17543278, 18566225, 18831788, 19147545, 19275204, 19342366, 19437484, 20228845, 20979115, 21258401 View all (43 more)
Prostatic Neoplasms	Stimulate	20929579, 32592689
Prostatic Neoplasms Castration Resistant	Associate	17595657, 27344294, 29693186, 30410767, 32183146, 36982155
Prostatitis	Associate	11141475, 16804520, 17148681, 17438134, 27732936, 28467474, 29271007, 30591689
Protein Losing Enteropathies	Associate	35318338
Pruritus	Associate	32270320
Psoriasis	Associate	16417229, 29859926, 36497125
Pterygium	Associate	32753832
Pulmonary Disease Chronic Obstructive	Associate	23877858, 33015805, 34206428, 34815425, 40594490
Pulmonary Fibrosis	Associate	26308397, 33760151
Purpura Thrombocytopenic	Stimulate	36544766
Pyruvate Carboxylase Deficiency Disease	Associate	33458757
Rectal Neoplasms	Associate	22121102, 31261557
Red Cell Aplasia Pure	Associate	24283217, 24350896, 30337298, 37142644
Renal Insufficiency	Associate	27304912, 36546418, 37628639
Respiratory Distress Syndrome	Associate	31566109, 35222683
Respiratory Tract Infections	Associate	29200949, 33734873
Retinal Diseases	Associate	32945388
Retinal Dysplasia	Associate	22021169
Retinoblastoma	Associate	32369777, 35369571, 35980647, 36005200
Rhabdomyosarcoma	Associate	17598902, 26373715
Ring Chromosome 20 Syndrome	Associate	30024306
Rotator Cuff Injuries	Associate	28634854
Rufous oculocutaneous albinism	Associate	23590999
Salivary Gland Adenoma Pleomorphic	Associate	27286739
Salivary Gland Neoplasms	Associate	19272817
Sarcoidosis	Associate	24283217, 24768588
Sarcoma	Associate	17598902, 35069780, 39778225
Sarcoma Alveolar Soft Part	Associate	32127467
Sarcoma Ewing	Associate	23800680, 25092916, 30131449
Sarcoma Kaposi	Associate	12531804, 23740979, 26339061, 37883374
Scleroderma Systemic	Associate	30641535
Seizures	Associate	36825472
Sepsis	Associate	30921508, 31566109, 35222683
Severe Combined Immunodeficiency	Associate	36544766
Sezary Syndrome	Associate	18200050, 21085192, 21938013, 24621498, 24756111, 26376612, 30910759
Shock Septic	Associate	37359526
Short Stature Idiopathic Autosomal	Associate	16884491
Shwachman Diamond Syndrome	Associate	40021961
Sick Sinus Syndrome	Associate	29137038
Sjogren's Syndrome	Associate	24827536, 29604049, 30150979, 35795677, 36072585
Skin Diseases	Associate	35258358, 36842846
Skin Neoplasms	Associate	24460316
Sleep Deprivation	Associate	23440187
Small Cell Lung Carcinoma	Associate	12509453, 22938476, 29020964, 33535997, 35583004
Soft Tissue Neoplasms	Associate	21575192
Spherocytosis Hereditary	Associate	33519826
Spinal Cord Diseases	Associate	32717400
Spinocerebellar Ataxia 17	Associate	19577286, 25880788
Spinocerebellar Ataxias	Associate	33519826
Splenic Neoplasms	Associate	22488042
Spondylitis Ankylosing	Associate	21152001, 35065610
Squamous Cell Carcinoma of Head and Neck	Associate	11927016, 12015764, 12454768, 12640143, 12771142, 15316561, 16984731, 17013800, 17498291, 19318490, 19484147, 19638453, 20371693, 20622897, 20682796 View all (43 more)
Squamous Cell Carcinoma of Head and Neck	Stimulate	23028842, 36361568
Staphylococcal Infections	Associate	30315710
Staphylococcal Skin Infections	Associate	30315710
Status Asthmaticus	Associate	18841165, 35172835
Stomach Diseases	Associate	23322197
Stomach Neoplasms	Associate	15682485, 20939893, 21072904, 21633597, 21730976, 22159814, 22351606, 23382965, 23402362, 23704922, 23824569, 23824571, 24116074, 24696730, 24864251 View all (67 more)
Stomatitis	Associate	28381801
Subarachnoid Hemorrhage	Associate	35700456
Substance Related Disorders	Associate	31685825
Synovitis	Associate	22736176, 7500028
talaromycosis	Associate	31572394, 32482141, 32493232, 33894704
Tarlov Cysts	Associate	37563649
Teratozoospermia	Associate	26209830
Tertiary Lymphoid Structures	Associate	25337233
Tertiary Lymphoid Structures	Stimulate	29137038
Testicular Germ Cell Tumor	Associate	35341013
Thrombocytopenia	Associate	31866622
Thymic epithelial tumor	Associate	23590999
Thymoma	Associate	30337298
Thyroid cancer medullary	Associate	27620278
Thyroid Cancer Papillary	Associate	21577321, 30964171, 31936675, 32182833, 32285621, 32851683, 32960462, 35090515, 35543351, 37671970
Thyroid Carcinoma Anaplastic	Associate	19825993, 29561707, 31958078, 35491899, 35769818, 36430869
Thyroid Neoplasms	Associate	31135274, 31936675, 33247999, 35769818, 35813296, 37897947, 40198658
Thyroid Nodule	Associate	20558345
Thyroiditis	Associate	22527947
Thyroiditis Autoimmune	Associate	24081513
Tinnitus	Associate	36401375
Tongue Neoplasms	Associate	32281236
Tooth Diseases	Associate	36370067
Trauma Nervous System	Associate	34471635, 37552127
Triple Negative Breast Neoplasms	Associate	28030809, 28729467, 29621649, 30826569, 31427441, 31850822, 32032581, 32406563, 32724453, 32816914, 33725911, 34067421, 34638797, 35053370, 35429924 View all (12 more)
Triple Negative Breast Neoplasms	Stimulate	36922898
Tuberculosis	Associate	19915152, 26776907, 30886421, 35839170, 36439164
Tuberculosis Lymph Node	Associate	36439164
Tuberculosis Multidrug Resistant	Associate	21677772, 27249600
Tuberous Sclerosis 1	Associate	36231025
Urethral Neoplasms	Associate	19951849, 32102537
Urinary Bladder Neoplasms	Associate	18939995, 21408190, 23392170, 23526079, 25849286, 27322953, 27556503, 29190807, 29517678, 29665744, 30864733, 31529191, 31661119, 32102537, 35783012 View all (7 more)
Urologic Neoplasms	Associate	30091994
Urticaria Solar	Stimulate	38184075
Uterine Cervical Dysplasia	Associate	17110342, 39684873
Uterine Cervical Neoplasms	Associate	17311011, 19638983, 20977777, 23874455, 25539644, 27690342, 28455960, 29610452, 29716674, 30024597, 30333561, 30720156, 31210293, 31487312, 31638249 View all (7 more)
Uterine Cervicitis	Associate	20977777, 29630659
Uterine Diseases	Associate	35279667
Uveal melanoma	Associate	29899166, 33682883
Vascular Calcification	Associate	31461977
Vascular Remodeling	Associate	21494893
Ventricular Remodeling	Associate	34939316
Virus Diseases	Associate	23830147
Vitiligo	Associate	33200798
Vitreoretinopathy Proliferative	Associate	31608440
Waldenstrom Macroglobulinemia	Associate	22976953
Weight Gain	Associate	35677041
Weight Loss	Associate	21147860
Wilms Tumor	Stimulate	23333300

STAT3 (signal transducer and activator of transcription 3)