Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6773
Gene name Gene Name - the full gene name approved by the HGNC.
Signal transducer and activator of transcription 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
STAT2
Synonyms (NCBI Gene) Gene synonyms aliases
IMD44, ISGF-3, P113, PTORCH3, STAT113
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q13.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the ce
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs281874770 C>G Pathogenic Intron variant, upstream transcript variant, genic upstream transcript variant
rs781522558 G>C,T Pathogenic Downstream transcript variant, non coding transcript variant, missense variant, stop gained, genic downstream transcript variant, coding sequence variant
rs1565648608 G>A Pathogenic Non coding transcript variant, coding sequence variant, downstream transcript variant, stop gained, genic downstream transcript variant
rs1592475699 C>- Likely-pathogenic Non coding transcript variant, splice donor variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017906 hsa-miR-335-5p Microarray 18185580
MIRT045759 hsa-miR-125a-5p CLASH 23622248
MIRT681524 hsa-miR-1295b-5p HITS-CLIP 23706177
MIRT681523 hsa-miR-1912 HITS-CLIP 23706177
MIRT681522 hsa-miR-3130-5p HITS-CLIP 23706177
Transcription factors
Transcription factor Regulation Reference
BRCA1 Activation 17374731
STAT1 Activation 16918696
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IC 31127039
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IDA 9020188
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600556 11363 ENSG00000170581
Protein
UniProt ID P52630
Protein name Signal transducer and activator of transcription 2 (p113)
Protein function Signal transducer and activator of transcription that mediates signaling by type I interferons (IFN-alpha and IFN-beta). Following type I IFN binding to cell surface receptors, Jak kinases (TYK2 and JAK1) are activated, leading to tyrosine phosp
PDB 2KA4 , 6UX2 , 6WCZ , 8T12 , 8T13
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02865 STAT_int 2 123 STAT protein, protein interaction domain Domain
PF01017 STAT_alpha 142 308 STAT protein, all-alpha domain Family
PF02864 STAT_bind 320 456 STAT protein, DNA binding domain Domain
PF00017 SH2 576 648 SH2 domain Domain
PF12188 STAT2_C 783 838 Signal transducer and activator of transcription 2 C terminal Domain
Sequence
MAQWEMLQNLDSPFQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEAALGSDDSKATMLF
FHFLDQLNYECGRCSQDPESLLLQHNLRKFCRDIQPFSQDPTQLAEMIFNLLLEEKRILI
QAQ
RAQLEQGEPVLETPVESQQHEIESRILDLRAMMEKLVKSISQLKDQQDVFCFRYKIQ
AKGKTPSLDPHQTKEQKILQETLNELDKRRKEVLDASKALLGRLTTLIELLLPKLEEWKA
QQQKACIRAPIDHGLEQLETWFTAGAKLLFHLRQLLKELKGLSCLVSYQDDPLTKGVDLR
NAQVTELL
QRLLHRAFVVETQPCMPQTPHRPLILKTGSKFTVRTRLLVRLQEGNESLTVE
VSIDRNPPQLQGFRKFNILTSNQKTLTPEKGQSQGLIWDFGYLTLVEQRSGGSGKGSNKG
PLGVTEELHIISFTVKYTYQGLKQELKTDTLPVVII
SNMNQLSIAWASVLWFNLLSPNLQ
NQQFFSNPPKAPWSLLGPALSWQFSSYVGRGLNSDQLSMLRNKLFGQNCRTEDPLLSWAD
FTKRESPPGKLPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRSQERRLLKKTMSGTFLL
RFSESSEGGITCSWVEHQDDDKVLIYSVQPYTKEVLQSLPLTEIIRHY
QLLTEENIPENP
LRFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSNRQVDELQQPLELKPEPELES
LELELGLVPEPELSLDLEPLLKAGLDLGPELESVLESTLEPVIEPTLCMVSQTVPEPDQG
PVSQPVPEPDLPCDLRHLNTEPMEIFRNCVKIEEIMPNGDPLLAGQNTVDEVYVSRPSHF
YTDGPLMPSDF
Sequence length 851
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Chemokine signaling pathway
Necroptosis
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
C-type lectin receptor signaling pathway
JAK-STAT signaling pathway
Hepatitis C
Hepatitis B
Measles
Influenza A
Human papillomavirus infection
Kaposi sarcoma-associated herpesvirus infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Coronavirus disease - COVID-19
Pathways in cancer
  Interleukin-20 family signaling
Interferon alpha/beta signaling
Regulation of IFNA signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Pseudo-TORCH Syndrome pseudo-TORCH syndrome 3 N/A N/A GenCC
Psoriasis Psoriasis N/A N/A GWAS
Psoriasis vulgaris Psoriasis vulgaris N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 36524113
Atherosclerosis Associate 36720950
Atrial Fibrillation Associate 36226239
Baraitser Brett Piesowicz syndrome Associate 36753016
Birt Hogg Dube Syndrome Associate 33459596
Breast Neoplasms Associate 28422733, 29326301, 32391191, 32883354, 36222718
Carcinogenesis Associate 37115061
Carcinoma Non Small Cell Lung Associate 27418131
Carcinoma Renal Cell Stimulate 32640276
Carcinoma Renal Cell Associate 33110456, 37115061, 37600786