Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6772
Gene name	Signal transducer and activator of transcription 1
Gene symbol	STAT1
Synonyms (NCBI Gene)	CANDF7IMD31AIMD31BIMD31CISGF-3STAT91
Chromosome	2
Chromosome location	2q32.2
Summary	The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the ce

Show/Hide all (47)

SNP ID	Visualize variation	Clinical significance	Consequence
rs41473544	C>T	Likely-benign, pathogenic, uncertain-significance	Coding sequence variant, missense variant, non coding transcript variant
rs56228116	C>T	Likely-benign, conflicting-interpretations-of-pathogenicity	Intron variant
rs137852677	A>G	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs137852678	A>G	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs137852679	C>A,T	Pathogenic	Non coding transcript variant, synonymous variant, coding sequence variant, missense variant
rs137852680	C>G	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs387906758	G>A,C	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs387906759	G>A	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs387906760	C>T	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs387906761	T>A	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs387906762	T>C	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs387906763	A>G	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs387906764	T>C	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs387906765	T>C	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs387906766	A>T	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs387906767	C>G	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs387906768	T>G	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs587776713	TC>-	Pathogenic	Non coding transcript variant, coding sequence variant, frameshift variant
rs587776714	->T	Pathogenic	Non coding transcript variant, coding sequence variant, frameshift variant
rs587776870	C>A	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs587777628	G>T	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs587777629	T>C	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs587777630	G>A	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs587777704	T>C	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs587777705	T>C	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs755837357	TTCT>-	Likely-pathogenic	Frameshift variant, coding sequence variant, non coding transcript variant
rs778254943	G>A	Likely-pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs796065052	C>T	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs863223398	T>C	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs886043118	T>-	Pathogenic	Coding sequence variant, frameshift variant, non coding transcript variant
rs1064794955	C>A	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs1085307649	G>T	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs1341038926	->C	Likely-pathogenic	Non coding transcript variant, coding sequence variant, frameshift variant
rs1553494436	A>C	Likely-pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs1553495184	T>C	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs1553496850	T>C	Likely-pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs1553497886	T>A	Likely-pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs1559011859	T>G	Likely-pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs1559019204	C>T	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs1574636674	G>A	Likely-pathogenic	Non coding transcript variant, genic downstream transcript variant, coding sequence variant, missense variant
rs1574640523	C>A	Likely-pathogenic	Non coding transcript variant, stop gained, coding sequence variant
rs1574648928	C>G	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs1574653439	A>G	Likely-pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs1574657735	A>C	Likely-pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs1574657750	C>T	Likely-pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs1574657762	A>C	Likely-pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs1574672718	C>G	Likely-pathogenic	Non coding transcript variant, coding sequence variant, missense variant

400

Show/Hide all (400)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000626	hsa-miR-145-5p	qRT-PCRLuciferase reporter assayWestern blotMicroarray	20098684
MIRT000626	hsa-miR-145-5p	Luciferase reporter assay	20098684
MIRT021229	hsa-miR-146a-5p	Microarray	20110513
MIRT025278	hsa-miR-34a-5p	Proteomics	21566225
MIRT040456	hsa-miR-615-3p	CLASH	23622248
MIRT021229	hsa-miR-146a-5p	Luciferase reporter assayqRT-PCRWestern blot	23890093
MIRT021229	hsa-miR-146a-5p	Luciferase reporter assayqRT-PCRWestern blot	23890093
MIRT640324	hsa-miR-605-5p	HITS-CLIP	23824327
MIRT640323	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT640322	hsa-miR-1183	HITS-CLIP	23824327
MIRT640321	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT640320	hsa-miR-5009-3p	HITS-CLIP	23824327
MIRT640319	hsa-miR-4693-5p	HITS-CLIP	23824327
MIRT640318	hsa-miR-7158-3p	HITS-CLIP	23824327
MIRT640317	hsa-miR-203b-3p	HITS-CLIP	23824327
MIRT640316	hsa-miR-653-5p	HITS-CLIP	23824327
MIRT731704	hsa-miR-140-5p	5.0	26780721
MIRT731704	hsa-miR-140-5p	5.0	26780721
MIRT021229	hsa-miR-146a-5p	qRT-PCRWestern blot	25889446
MIRT735637	hsa-miR-223-3p	Luciferase reporter assayqRT-PCRWestern blot	26025667
MIRT735637	hsa-miR-223-3p	Luciferase reporter assayqRT-PCRWestern blot	26025667
MIRT735637	hsa-miR-223-3p	Luciferase reporter assayqRT-PCRWestern blot	26025667
MIRT735637	hsa-miR-223-3p	Luciferase reporter assayqRT-PCRWestern blot	26025667
MIRT021229	hsa-miR-146a-5p	qRT-PCR	28077577
MIRT732496	hsa-miR-6825-5p	Microarray	32597160
MIRT732497	hsa-miR-4495	Microarray	32597160
MIRT732498	hsa-miR-5580-3p	Microarray	32597160
MIRT732806	hsa-miR-455-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blotting	33505218
MIRT732903	hsa-let-7i-3p	ImmunofluorescenceRNA-seqqRT-PCRWestern blotting	33239422
MIRT732905	hsa-miR-423-3p	ImmunofluorescenceRNA-seqqRT-PCRWestern blotting	33239422
MIRT734444	hsa-let-7b-5p	ELISALuciferase reporter assayqRT-PCR	33005103
MIRT735199	hsa-miR-103a-2-5p	Luciferase reporter assayWestern blottingMicroarrayImmunohistochemistry (IHC)ImmunofluorescenceqRT-PCRIn situ hybridizationFlow cytometry	32549769
MIRT735637	hsa-miR-223-3p	qRT-PCR	32048448
MIRT735638	hsa-miR-448	qRT-PCR	32048448
MIRT640324	hsa-miR-605-5p	HITS-CLIP	23824327
MIRT640323	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT640322	hsa-miR-1183	HITS-CLIP	23824327
MIRT640321	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT640320	hsa-miR-5009-3p	HITS-CLIP	23824327
MIRT640319	hsa-miR-4693-5p	HITS-CLIP	23824327
MIRT640318	hsa-miR-7158-3p	HITS-CLIP	23824327
MIRT640317	hsa-miR-203b-3p	HITS-CLIP	23824327
MIRT640316	hsa-miR-653-5p	HITS-CLIP	23824327
MIRT755907	hsa-miR-1296-5p	Luciferase reporter assayWestern blottingqRT-PCRRNA pull down assay	37187897
MIRT756283	hsa-miR-338-3p	Luciferase reporter assayWestern blottingqRT-PCR	37479855
MIRT1395625	hsa-miR-1257	CLIP-seq
MIRT1395626	hsa-miR-1261	CLIP-seq
MIRT1395627	hsa-miR-1273g	CLIP-seq
MIRT1395628	hsa-miR-146a	CLIP-seq
MIRT1395629	hsa-miR-146b-5p	CLIP-seq
MIRT1395630	hsa-miR-155	CLIP-seq
MIRT1395631	hsa-miR-185	CLIP-seq
MIRT1395632	hsa-miR-3074-3p	CLIP-seq
MIRT1395633	hsa-miR-3121-3p	CLIP-seq
MIRT1395634	hsa-miR-3123	CLIP-seq
MIRT1395635	hsa-miR-3148	CLIP-seq
MIRT1395636	hsa-miR-3201	CLIP-seq
MIRT1395637	hsa-miR-323b-5p	CLIP-seq
MIRT1395638	hsa-miR-3607-3p	CLIP-seq
MIRT1395639	hsa-miR-3611	CLIP-seq
MIRT1395640	hsa-miR-3688-3p	CLIP-seq
MIRT1395641	hsa-miR-3689a-3p	CLIP-seq
MIRT1395642	hsa-miR-3689c	CLIP-seq
MIRT1395643	hsa-miR-4287	CLIP-seq
MIRT1395644	hsa-miR-4306	CLIP-seq
MIRT1395645	hsa-miR-4422	CLIP-seq
MIRT1395646	hsa-miR-4481	CLIP-seq
MIRT1395647	hsa-miR-4644	CLIP-seq
MIRT1395648	hsa-miR-4662a-5p	CLIP-seq
MIRT1395649	hsa-miR-4685-3p	CLIP-seq
MIRT1395650	hsa-miR-4700-3p	CLIP-seq
MIRT1395651	hsa-miR-4745-5p	CLIP-seq
MIRT1395652	hsa-miR-4758-5p	CLIP-seq
MIRT1395653	hsa-miR-4764-3p	CLIP-seq
MIRT1395654	hsa-miR-4768-3p	CLIP-seq
MIRT1395655	hsa-miR-4780	CLIP-seq
MIRT1395656	hsa-miR-4789-3p	CLIP-seq
MIRT1395657	hsa-miR-4791	CLIP-seq
MIRT1395658	hsa-miR-494	CLIP-seq
MIRT1395659	hsa-miR-548a-3p	CLIP-seq
MIRT1395660	hsa-miR-548c-3p	CLIP-seq
MIRT1395661	hsa-miR-548e	CLIP-seq
MIRT1395662	hsa-miR-548f	CLIP-seq
MIRT1395663	hsa-miR-570	CLIP-seq
MIRT1395664	hsa-miR-623	CLIP-seq
MIRT1395665	hsa-miR-630	CLIP-seq
MIRT1395666	hsa-miR-656	CLIP-seq
MIRT1395667	hsa-miR-935	CLIP-seq
MIRT1395668	hsa-miR-30a	CLIP-seq
MIRT1395669	hsa-miR-30b	CLIP-seq
MIRT1395670	hsa-miR-30c	CLIP-seq
MIRT1395671	hsa-miR-30d	CLIP-seq
MIRT1395672	hsa-miR-30e	CLIP-seq
MIRT1395673	hsa-miR-3119	CLIP-seq
MIRT1395674	hsa-miR-4464	CLIP-seq
MIRT1395675	hsa-miR-4639-3p	CLIP-seq
MIRT1395676	hsa-miR-4748	CLIP-seq
MIRT1395677	hsa-miR-668	CLIP-seq
MIRT1554200	hsa-miR-199a-3p	CLIP-seq
MIRT1554201	hsa-miR-199b-3p	CLIP-seq
MIRT1554202	hsa-miR-3129-5p	CLIP-seq
MIRT1395635	hsa-miR-3148	CLIP-seq
MIRT1395639	hsa-miR-3611	CLIP-seq
MIRT1554203	hsa-miR-3681	CLIP-seq
MIRT1554204	hsa-miR-4274	CLIP-seq
MIRT1554205	hsa-miR-4519	CLIP-seq
MIRT1395659	hsa-miR-548a-3p	CLIP-seq
MIRT1395661	hsa-miR-548e	CLIP-seq
MIRT1395662	hsa-miR-548f	CLIP-seq
MIRT2118687	hsa-miR-1252	CLIP-seq
MIRT2118688	hsa-miR-1273d	CLIP-seq
MIRT1395639	hsa-miR-3611	CLIP-seq
MIRT2118689	hsa-miR-376c	CLIP-seq
MIRT2118690	hsa-miR-4277	CLIP-seq
MIRT2118691	hsa-miR-4496	CLIP-seq
MIRT2118692	hsa-miR-4697-3p	CLIP-seq
MIRT2118693	hsa-miR-513c	CLIP-seq
MIRT2118694	hsa-miR-514b-5p	CLIP-seq
MIRT2118695	hsa-miR-548b-3p	CLIP-seq
MIRT1395667	hsa-miR-935	CLIP-seq
MIRT2118696	hsa-miR-4708-3p	CLIP-seq
MIRT1395668	hsa-miR-30a	CLIP-seq
MIRT1395669	hsa-miR-30b	CLIP-seq
MIRT1395670	hsa-miR-30c	CLIP-seq
MIRT1395671	hsa-miR-30d	CLIP-seq
MIRT1395672	hsa-miR-30e	CLIP-seq
MIRT1395674	hsa-miR-4464	CLIP-seq
MIRT1395676	hsa-miR-4748	CLIP-seq
MIRT2433629	hsa-miR-1297	CLIP-seq
MIRT1554200	hsa-miR-199a-3p	CLIP-seq
MIRT1554201	hsa-miR-199b-3p	CLIP-seq
MIRT2433630	hsa-miR-223	CLIP-seq
MIRT2433631	hsa-miR-26a	CLIP-seq
MIRT2433632	hsa-miR-26b	CLIP-seq
MIRT1554202	hsa-miR-3129-5p	CLIP-seq
MIRT2433633	hsa-miR-3140-3p	CLIP-seq
MIRT1395635	hsa-miR-3148	CLIP-seq
MIRT1554203	hsa-miR-3681	CLIP-seq
MIRT2118689	hsa-miR-376c	CLIP-seq
MIRT2433634	hsa-miR-380	CLIP-seq
MIRT2433635	hsa-miR-382	CLIP-seq
MIRT2433636	hsa-miR-4272	CLIP-seq
MIRT1554204	hsa-miR-4274	CLIP-seq
MIRT2433637	hsa-miR-4299	CLIP-seq
MIRT2433638	hsa-miR-4456	CLIP-seq
MIRT2433639	hsa-miR-4465	CLIP-seq
MIRT1554205	hsa-miR-4519	CLIP-seq
MIRT2433640	hsa-miR-4536	CLIP-seq
MIRT2433641	hsa-miR-4691-3p	CLIP-seq
MIRT2118692	hsa-miR-4697-3p	CLIP-seq
MIRT2433642	hsa-miR-4795-3p	CLIP-seq
MIRT2433643	hsa-miR-548q	CLIP-seq
MIRT1395667	hsa-miR-935	CLIP-seq
MIRT2634677	hsa-miR-101	CLIP-seq
MIRT2634678	hsa-miR-1227	CLIP-seq
MIRT1395625	hsa-miR-1257	CLIP-seq
MIRT2634679	hsa-miR-1262	CLIP-seq
MIRT1395627	hsa-miR-1273g	CLIP-seq
MIRT2634680	hsa-miR-1303	CLIP-seq
MIRT2634681	hsa-miR-1305	CLIP-seq
MIRT2634682	hsa-miR-1322	CLIP-seq
MIRT2634683	hsa-miR-1323	CLIP-seq
MIRT2634684	hsa-miR-144	CLIP-seq
MIRT1395628	hsa-miR-146a	CLIP-seq
MIRT1395629	hsa-miR-146b-5p	CLIP-seq
MIRT2634685	hsa-miR-150	CLIP-seq
MIRT1395630	hsa-miR-155	CLIP-seq
MIRT1395631	hsa-miR-185	CLIP-seq
MIRT2634686	hsa-miR-188-3p	CLIP-seq
MIRT1554200	hsa-miR-199a-3p	CLIP-seq
MIRT1554201	hsa-miR-199b-3p	CLIP-seq
MIRT2634687	hsa-miR-2113	CLIP-seq
MIRT2634688	hsa-miR-27a	CLIP-seq
MIRT2634689	hsa-miR-27b	CLIP-seq
MIRT2634690	hsa-miR-297	CLIP-seq
MIRT1395632	hsa-miR-3074-3p	CLIP-seq
MIRT1395673	hsa-miR-3119	CLIP-seq
MIRT2634691	hsa-miR-3120-3p	CLIP-seq
MIRT1395634	hsa-miR-3123	CLIP-seq
MIRT2634692	hsa-miR-3126-3p	CLIP-seq
MIRT1554202	hsa-miR-3129-5p	CLIP-seq
MIRT2634693	hsa-miR-3143	CLIP-seq
MIRT1395635	hsa-miR-3148	CLIP-seq
MIRT2634694	hsa-miR-3149	CLIP-seq
MIRT2634695	hsa-miR-3163	CLIP-seq
MIRT2634696	hsa-miR-3189-3p	CLIP-seq
MIRT1395637	hsa-miR-323b-5p	CLIP-seq
MIRT2634697	hsa-miR-3545-3p	CLIP-seq
MIRT1395638	hsa-miR-3607-3p	CLIP-seq
MIRT1395639	hsa-miR-3611	CLIP-seq
MIRT2634698	hsa-miR-3614-5p	CLIP-seq
MIRT2634699	hsa-miR-3653	CLIP-seq
MIRT2634700	hsa-miR-3658	CLIP-seq
MIRT1554203	hsa-miR-3681	CLIP-seq
MIRT2634701	hsa-miR-3685	CLIP-seq
MIRT1395640	hsa-miR-3688-3p	CLIP-seq
MIRT1395641	hsa-miR-3689a-3p	CLIP-seq
MIRT1395642	hsa-miR-3689c	CLIP-seq
MIRT2118689	hsa-miR-376c	CLIP-seq
MIRT2634702	hsa-miR-3919	CLIP-seq
MIRT2634703	hsa-miR-3925-5p	CLIP-seq
MIRT2634704	hsa-miR-3973	CLIP-seq
MIRT2634705	hsa-miR-410	CLIP-seq
MIRT2634706	hsa-miR-421	CLIP-seq
MIRT1554204	hsa-miR-4274	CLIP-seq
MIRT2118690	hsa-miR-4277	CLIP-seq
MIRT2634707	hsa-miR-4279	CLIP-seq
MIRT1395643	hsa-miR-4287	CLIP-seq
MIRT2634708	hsa-miR-4303	CLIP-seq
MIRT1395644	hsa-miR-4306	CLIP-seq
MIRT2634709	hsa-miR-4307	CLIP-seq
MIRT2634710	hsa-miR-4310	CLIP-seq
MIRT2634711	hsa-miR-4330	CLIP-seq
MIRT1395645	hsa-miR-4422	CLIP-seq
MIRT2634712	hsa-miR-4424	CLIP-seq
MIRT2634713	hsa-miR-4426	CLIP-seq
MIRT2634714	hsa-miR-4455	CLIP-seq
MIRT2634715	hsa-miR-4474-3p	CLIP-seq
MIRT1395646	hsa-miR-4481	CLIP-seq
MIRT2118691	hsa-miR-4496	CLIP-seq
MIRT1554205	hsa-miR-4519	CLIP-seq
MIRT2433640	hsa-miR-4536	CLIP-seq
MIRT1395647	hsa-miR-4644	CLIP-seq
MIRT2634716	hsa-miR-4647	CLIP-seq
MIRT2634717	hsa-miR-4662b	CLIP-seq
MIRT2634718	hsa-miR-4682	CLIP-seq
MIRT1395649	hsa-miR-4685-3p	CLIP-seq
MIRT2433641	hsa-miR-4691-3p	CLIP-seq
MIRT2634719	hsa-miR-4695-5p	CLIP-seq
MIRT1395650	hsa-miR-4700-3p	CLIP-seq
MIRT2634720	hsa-miR-4701-3p	CLIP-seq
MIRT2634721	hsa-miR-4709-5p	CLIP-seq
MIRT2634722	hsa-miR-4713-5p	CLIP-seq
MIRT2634723	hsa-miR-4720-3p	CLIP-seq
MIRT2634724	hsa-miR-4724-3p	CLIP-seq
MIRT2634725	hsa-miR-4738-3p	CLIP-seq
MIRT1395651	hsa-miR-4745-5p	CLIP-seq
MIRT2634726	hsa-miR-4756-3p	CLIP-seq
MIRT1395652	hsa-miR-4758-5p	CLIP-seq
MIRT2634727	hsa-miR-4762-3p	CLIP-seq
MIRT1395653	hsa-miR-4764-3p	CLIP-seq
MIRT2634728	hsa-miR-4764-5p	CLIP-seq
MIRT1395654	hsa-miR-4768-3p	CLIP-seq
MIRT2634729	hsa-miR-4775	CLIP-seq
MIRT1395655	hsa-miR-4780	CLIP-seq
MIRT2634730	hsa-miR-4782-5p	CLIP-seq
MIRT1395656	hsa-miR-4789-3p	CLIP-seq
MIRT2634731	hsa-miR-4804-3p	CLIP-seq
MIRT2634732	hsa-miR-491-3p	CLIP-seq
MIRT1395658	hsa-miR-494	CLIP-seq
MIRT2634733	hsa-miR-495	CLIP-seq
MIRT2634734	hsa-miR-508-3p	CLIP-seq
MIRT2634735	hsa-miR-5096	CLIP-seq
MIRT2634736	hsa-miR-513a-3p	CLIP-seq
MIRT2634737	hsa-miR-513a-5p	CLIP-seq
MIRT2118693	hsa-miR-513c	CLIP-seq
MIRT2118694	hsa-miR-514b-5p	CLIP-seq
MIRT2634738	hsa-miR-532-3p	CLIP-seq
MIRT2634739	hsa-miR-532-5p	CLIP-seq
MIRT2634740	hsa-miR-543	CLIP-seq
MIRT1395659	hsa-miR-548a-3p	CLIP-seq
MIRT2634741	hsa-miR-548ac	CLIP-seq
MIRT2634742	hsa-miR-548ae	CLIP-seq
MIRT2634743	hsa-miR-548ag	CLIP-seq
MIRT2634744	hsa-miR-548ai	CLIP-seq
MIRT2634745	hsa-miR-548aj	CLIP-seq
MIRT2634746	hsa-miR-548am	CLIP-seq
MIRT1395660	hsa-miR-548c-3p	CLIP-seq
MIRT2634747	hsa-miR-548d-3p	CLIP-seq
MIRT1395661	hsa-miR-548e	CLIP-seq
MIRT1395662	hsa-miR-548f	CLIP-seq
MIRT2634748	hsa-miR-548k	CLIP-seq
MIRT2634749	hsa-miR-548m	CLIP-seq
MIRT2634750	hsa-miR-548n	CLIP-seq
MIRT2634751	hsa-miR-548o	CLIP-seq
MIRT2634752	hsa-miR-548x	CLIP-seq
MIRT2634753	hsa-miR-548z	CLIP-seq
MIRT2634754	hsa-miR-562	CLIP-seq
MIRT2634755	hsa-miR-568	CLIP-seq
MIRT1395663	hsa-miR-570	CLIP-seq
MIRT2634756	hsa-miR-576-3p	CLIP-seq
MIRT2634757	hsa-miR-584	CLIP-seq
MIRT2634758	hsa-miR-586	CLIP-seq
MIRT2634759	hsa-miR-590-3p	CLIP-seq
MIRT2634760	hsa-miR-598	CLIP-seq
MIRT2634761	hsa-miR-609	CLIP-seq
MIRT1395664	hsa-miR-623	CLIP-seq
MIRT1395666	hsa-miR-656	CLIP-seq
MIRT2634762	hsa-miR-759	CLIP-seq
MIRT2634763	hsa-miR-892a	CLIP-seq
MIRT1395667	hsa-miR-935	CLIP-seq
MIRT2634764	hsa-miR-938	CLIP-seq
MIRT2634678	hsa-miR-1227	CLIP-seq
MIRT2634679	hsa-miR-1262	CLIP-seq
MIRT1395627	hsa-miR-1273g	CLIP-seq
MIRT2634680	hsa-miR-1303	CLIP-seq
MIRT2634681	hsa-miR-1305	CLIP-seq
MIRT2634682	hsa-miR-1322	CLIP-seq
MIRT2634683	hsa-miR-1323	CLIP-seq
MIRT2634685	hsa-miR-150	CLIP-seq
MIRT1395630	hsa-miR-155	CLIP-seq
MIRT2634686	hsa-miR-188-3p	CLIP-seq
MIRT1554200	hsa-miR-199a-3p	CLIP-seq
MIRT1554201	hsa-miR-199b-3p	CLIP-seq
MIRT2692198	hsa-miR-203	CLIP-seq
MIRT2692199	hsa-miR-2052	CLIP-seq
MIRT2634688	hsa-miR-27a	CLIP-seq
MIRT2634689	hsa-miR-27b	CLIP-seq
MIRT2634690	hsa-miR-297	CLIP-seq
MIRT1395632	hsa-miR-3074-3p	CLIP-seq
MIRT1395673	hsa-miR-3119	CLIP-seq
MIRT2634691	hsa-miR-3120-3p	CLIP-seq
MIRT1395634	hsa-miR-3123	CLIP-seq
MIRT2634692	hsa-miR-3126-3p	CLIP-seq
MIRT1554202	hsa-miR-3129-5p	CLIP-seq
MIRT2634693	hsa-miR-3143	CLIP-seq
MIRT1395635	hsa-miR-3148	CLIP-seq
MIRT2634694	hsa-miR-3149	CLIP-seq
MIRT2634695	hsa-miR-3163	CLIP-seq
MIRT2634697	hsa-miR-3545-3p	CLIP-seq
MIRT1395639	hsa-miR-3611	CLIP-seq
MIRT2634698	hsa-miR-3614-5p	CLIP-seq
MIRT1554203	hsa-miR-3681	CLIP-seq
MIRT2634701	hsa-miR-3685	CLIP-seq
MIRT1395640	hsa-miR-3688-3p	CLIP-seq
MIRT2118689	hsa-miR-376c	CLIP-seq
MIRT2634702	hsa-miR-3919	CLIP-seq
MIRT2634703	hsa-miR-3925-5p	CLIP-seq
MIRT2634704	hsa-miR-3973	CLIP-seq
MIRT2634705	hsa-miR-410	CLIP-seq
MIRT2634706	hsa-miR-421	CLIP-seq
MIRT1554204	hsa-miR-4274	CLIP-seq
MIRT2118690	hsa-miR-4277	CLIP-seq
MIRT2634707	hsa-miR-4279	CLIP-seq
MIRT2634708	hsa-miR-4303	CLIP-seq
MIRT2634709	hsa-miR-4307	CLIP-seq
MIRT2634710	hsa-miR-4310	CLIP-seq
MIRT2634711	hsa-miR-4330	CLIP-seq
MIRT1395645	hsa-miR-4422	CLIP-seq
MIRT2634712	hsa-miR-4424	CLIP-seq
MIRT2634713	hsa-miR-4426	CLIP-seq
MIRT2634714	hsa-miR-4455	CLIP-seq
MIRT1395646	hsa-miR-4481	CLIP-seq
MIRT2118691	hsa-miR-4496	CLIP-seq
MIRT1554205	hsa-miR-4519	CLIP-seq
MIRT2433640	hsa-miR-4536	CLIP-seq
MIRT2634716	hsa-miR-4647	CLIP-seq
MIRT2634717	hsa-miR-4662b	CLIP-seq
MIRT2634718	hsa-miR-4682	CLIP-seq
MIRT2634719	hsa-miR-4695-5p	CLIP-seq
MIRT2634720	hsa-miR-4701-3p	CLIP-seq
MIRT2634721	hsa-miR-4709-5p	CLIP-seq
MIRT2634722	hsa-miR-4713-5p	CLIP-seq
MIRT2634723	hsa-miR-4720-3p	CLIP-seq
MIRT2634724	hsa-miR-4724-3p	CLIP-seq
MIRT2634725	hsa-miR-4738-3p	CLIP-seq
MIRT1395651	hsa-miR-4745-5p	CLIP-seq
MIRT2634726	hsa-miR-4756-3p	CLIP-seq
MIRT1395652	hsa-miR-4758-5p	CLIP-seq
MIRT2634727	hsa-miR-4762-3p	CLIP-seq
MIRT2634728	hsa-miR-4764-5p	CLIP-seq
MIRT2634729	hsa-miR-4775	CLIP-seq
MIRT2634730	hsa-miR-4782-5p	CLIP-seq
MIRT1395656	hsa-miR-4789-3p	CLIP-seq
MIRT2634731	hsa-miR-4804-3p	CLIP-seq
MIRT2634732	hsa-miR-491-3p	CLIP-seq
MIRT1395658	hsa-miR-494	CLIP-seq
MIRT2634734	hsa-miR-508-3p	CLIP-seq
MIRT2634735	hsa-miR-5096	CLIP-seq
MIRT2634736	hsa-miR-513a-3p	CLIP-seq
MIRT2634737	hsa-miR-513a-5p	CLIP-seq
MIRT2118693	hsa-miR-513c	CLIP-seq
MIRT2118694	hsa-miR-514b-5p	CLIP-seq
MIRT2634738	hsa-miR-532-3p	CLIP-seq
MIRT2634739	hsa-miR-532-5p	CLIP-seq
MIRT2634740	hsa-miR-543	CLIP-seq
MIRT1395659	hsa-miR-548a-3p	CLIP-seq
MIRT2634741	hsa-miR-548ac	CLIP-seq
MIRT2634742	hsa-miR-548ae	CLIP-seq
MIRT2634745	hsa-miR-548aj	CLIP-seq
MIRT2634746	hsa-miR-548am	CLIP-seq
MIRT2634747	hsa-miR-548d-3p	CLIP-seq
MIRT1395661	hsa-miR-548e	CLIP-seq
MIRT1395662	hsa-miR-548f	CLIP-seq
MIRT2634751	hsa-miR-548o	CLIP-seq
MIRT2634752	hsa-miR-548x	CLIP-seq
MIRT2634753	hsa-miR-548z	CLIP-seq
MIRT2634754	hsa-miR-562	CLIP-seq
MIRT2634755	hsa-miR-568	CLIP-seq
MIRT1395663	hsa-miR-570	CLIP-seq
MIRT2634756	hsa-miR-576-3p	CLIP-seq
MIRT2634758	hsa-miR-586	CLIP-seq
MIRT2634759	hsa-miR-590-3p	CLIP-seq
MIRT2634760	hsa-miR-598	CLIP-seq
MIRT2634761	hsa-miR-609	CLIP-seq
MIRT1395666	hsa-miR-656	CLIP-seq
MIRT2634762	hsa-miR-759	CLIP-seq
MIRT2634763	hsa-miR-892a	CLIP-seq
MIRT1395667	hsa-miR-935	CLIP-seq
MIRT2634764	hsa-miR-938	CLIP-seq

Show/Hide all (14)

Transcription factor	Regulation	Reference
BRCA1	Activation	17374731
CIITA	Unknown	12052885
CREB5	Repression	21132541
EGF	Unknown	11939722
GTF3A	Unknown	12364590
MCM5	Unknown	11248027
NR3C1	Repression	17016446
PIAS1	Unknown	17940994;19136629
RELA	Unknown	25040843
REST	Repression	23598529
STAT2	Unknown	21498520
STAT3	Activation	22693070
STAT6	Repression	19440213
TP53	Unknown	12364590

133

Show/Hide all (133)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000785	Component	Chromatin	IDA	18035482
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	22002246
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	18035482, 21268089
GO:0000979	Function	RNA polymerase II core promoter sequence-specific DNA binding	IDA	23386060, 28753426
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	11972023, 21268089, 28753426, 32209697
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001222	Function	Transcription corepressor binding	IPI	23386060
GO:0001223	Function	Transcription coactivator binding	IPI	22002246
GO:0001937	Process	Negative regulation of endothelial cell proliferation	IMP	16585190
GO:0002053	Process	Positive regulation of mesenchymal cell proliferation	ISS
GO:0002230	Process	Positive regulation of defense response to virus by host	IGI	26479788
GO:0002230	Process	Positive regulation of defense response to virus by host	IMP	26479788
GO:0003340	Process	Negative regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IDA	9630226
GO:0003700	Function	DNA-binding transcription factor activity	IDA	10820245
GO:0003700	Function	DNA-binding transcription factor activity	IDA	9535918, 10820245, 10973496, 23386060
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005164	Function	Tumor necrosis factor receptor binding	IPI	10848577
GO:0005515	Function	Protein binding	IPI	8156998, 8605877, 8662591, 9121453, 9881977, 10848577, 11238845, 12070153, 12788789, 12867595, 15780933, 15825084, 16189514, 16273093, 16306601, 16531398, 16940534, 17275127, 17596301, 17923090, 20195357, 20576130, 21903422, 21988832, 24065129, 24335311, 24360797, 24658140, 25241761
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	9535918, 28753426
GO:0005634	Component	Nucleus	IDA	26479788
GO:0005634	Component	Nucleus	IDA	15322115, 18035482
GO:0005634	Component	Nucleus	IDA	10692450, 10973496, 15825084, 16306601, 21268089, 23386060, 28753426, 32209697
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	10692450, 10973496, 15825084, 17275127, 23386060, 26479788, 27796300, 28753426, 32209697
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	10820245
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	28753426
GO:0006952	Process	Defense response	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IBA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	11972023, 22002246, 28753426
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	NAS	9630226, 24058793
GO:0007584	Process	Response to nutrient	IEA
GO:0008015	Process	Blood circulation	IEA
GO:0008015	Process	Blood circulation	ISS
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IMP	16585190
GO:0019899	Function	Enzyme binding	IPI	26479788
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0031730	Function	CCR5 chemokine receptor binding	IEA
GO:0032727	Process	Positive regulation of interferon-alpha production	IDA	28753426
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032991	Component	Protein-containing complex	IDA	26479788
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IDA	10848577
GO:0034097	Process	Response to cytokine	IEA
GO:0034097	Process	Response to cytokine	ISS
GO:0034341	Process	Response to type II interferon	IDA	11972023
GO:0035035	Function	Histone acetyltransferase binding	IPI	26479788
GO:0035456	Process	Response to interferon-beta	IMP	24882218
GO:0035458	Process	Cellular response to interferon-beta	IDA	28753426
GO:0035458	Process	Cellular response to interferon-beta	IMP	18035482
GO:0038111	Process	Interleukin-7-mediated signaling pathway	IDA	29202461
GO:0038113	Process	Interleukin-9-mediated signaling pathway	IDA	9535918
GO:0042127	Process	Regulation of cell population proliferation	IBA
GO:0042393	Function	Histone binding	IPI	26479788
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0042802	Function	Identical protein binding	IPI	8605877, 9630226, 18591661
GO:0042803	Function	Protein homodimerization activity	IDA	9630226, 28753426
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0042981	Process	Regulation of apoptotic process	TAS	12108949
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IMP	10848577
GO:0043434	Process	Response to peptide hormone	IBA
GO:0043434	Process	Response to peptide hormone	IEA
GO:0043434	Process	Response to peptide hormone	ISS
GO:0043542	Process	Endothelial cell migration	IMP	16585190
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0044389	Function	Ubiquitin-like protein ligase binding	IPI	26479788
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IEA
GO:0045648	Process	Positive regulation of erythrocyte differentiation	IMP	28283061
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	10973496
GO:0045893	Process	Positive regulation of DNA-templated transcription	IGI	26479788
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	26479788
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10820245, 24065129, 32209697
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	18035482
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	NAS	9630226, 24058793
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IDA	16257975
GO:0046725	Process	Negative regulation by virus of viral protein levels in host cell	IMP	15825084
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	17275127
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	ISS
GO:0051093	Process	Negative regulation of developmental process	IEA
GO:0051591	Process	Response to cAMP	IEA
GO:0051591	Process	Response to cAMP	ISS
GO:0051607	Process	Defense response to virus	IDA	28753426
GO:0051607	Process	Defense response to virus	IEA
GO:0051721	Function	Protein phosphatase 2A binding	IEA
GO:0060333	Process	Type II interferon-mediated signaling pathway	IDA	21268089
GO:0060333	Process	Type II interferon-mediated signaling pathway	IEA
GO:0060333	Process	Type II interferon-mediated signaling pathway	IMP	26479788
GO:0060333	Process	Type II interferon-mediated signaling pathway	ISS
GO:0060337	Process	Type I interferon-mediated signaling pathway	IBA
GO:0060337	Process	Type I interferon-mediated signaling pathway	IDA	23386060
GO:0060337	Process	Type I interferon-mediated signaling pathway	IEA
GO:0060337	Process	Type I interferon-mediated signaling pathway	ISS
GO:0061326	Process	Renal tubule development	IMP	20861313
GO:0070106	Process	Interleukin-27-mediated signaling pathway	IDA	32270034
GO:0070721	Component	ISGF3 complex	IBA
GO:0070721	Component	ISGF3 complex	IPI	24065129
GO:0071345	Process	Cellular response to cytokine stimulus	IEA
GO:0071346	Process	Cellular response to type II interferon	IDA	11972023, 23386060
GO:0072136	Process	Metanephric mesenchymal cell proliferation involved in metanephros development	ISS
GO:0072162	Process	Metanephric mesenchymal cell differentiation	ISS
GO:0072308	Process	Negative regulation of metanephric nephron tubule epithelial cell differentiation	ISS
GO:0090575	Component	RNA polymerase II transcription regulator complex	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	8662591, 9630226
GO:0090575	Component	RNA polymerase II transcription regulator complex	NAS	24058793
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IDA	18035482
GO:1990841	Function	Promoter-specific chromatin binding	IDA	26479788

MIM	HGNC	e!Ensembl
600555	11362	ENSG00000115415

P42224

Protein name

Signal transducer and activator of transcription 1-alpha/beta (Transcription factor ISGF-3 components p91/p84)

Protein function

Signal transducer and transcription activator that mediates cellular responses to interferons (IFNs), cytokine KITLG/SCF and other cytokines and other growth factors (PubMed:12764129, PubMed:12855578, PubMed:15322115, PubMed:23940278, PubMed:345

PDB

1BF5 , 1YVL , 2KA6 , 3WWT , 7NUF , 8D3F

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02865	STAT_int	2 → 120	STAT protein, protein interaction domain	Domain
PF01017	STAT_alpha	139 → 309	STAT protein, all-alpha domain	Family
PF02864	STAT_bind	321 → 458	STAT protein, DNA binding domain	Domain
PF00017	SH2	573 → 657	SH2 domain	Domain
PF12162	STAT1_TAZ2bind	715 → 739	STAT1 TAZ2 binding domain	Motif

Sequence

MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQ
RFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNR
EHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWK
RRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQV
LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLTPPCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFL
LRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEVSRIVGSVEFDSMMNTV

Sequence length

750

Interactions

View interactions

	KEGG		Reactome
	Chemokine signaling pathway Necroptosis Osteoclast differentiation Toll-like receptor signaling pathway NOD-like receptor signaling pathway C-type lectin receptor signaling pathway JAK-STAT signaling pathway Th1 and Th2 cell differentiation Th17 cell differentiation Prolactin signaling pathway Thyroid hormone signaling pathway AGE-RAGE signaling pathway in diabetic complications Growth hormone synthesis, secretion and action Leishmaniasis Toxoplasmosis Tuberculosis Hepatitis C Hepatitis B Measles Influenza A Human papillomavirus infection Kaposi sarcoma-associated herpesvirus infection Herpes simplex virus 1 infection Epstein-Barr virus infection Coronavirus disease - COVID-19 Pathways in cancer Pancreatic cancer PD-L1 expression and PD-1 checkpoint pathway in cancer Inflammatory bowel disease		Interleukin-6 signaling ISG15 antiviral mechanism Signaling by SCF-KIT Signaling by cytosolic FGFR1 fusion mutants Downstream signal transduction Interleukin-4 and Interleukin-13 signaling Interferon gamma signaling Regulation of IFNG signaling Interleukin-20 family signaling Interleukin-35 Signalling Interleukin-9 signaling NOTCH3 Intracellular Domain Regulates Transcription Interleukin-27 signaling Interleukin-21 signaling Interferon alpha/beta signaling Regulation of IFNA signaling Signaling by PDGFRA transmembrane, juxtamembrane and kinase domain mutants Signaling by PDGFRA extracellular domain mutants

1677

Show/Hide Causal Diseases (7)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Autoimmune enteropathy and endocrinopathy - susceptibility to chronic infections syndrome	Pathogenic; Likely pathogenic	rs763759889, rs2124996723, rs1382612689, rs2124996603, rs2125062900, rs2125029430, rs2125075054, rs2125000306, rs587777628, rs587777629, rs587777630, rs387906758, rs2470465165, rs1417484130, rs1559011859 View all (37 more)	RCV001387601 RCV002031476 RCV001953772 RCV002046903 RCV001943557 RCV001925332 RCV002003654 RCV001887932 RCV000133513 RCV000133514 RCV000133515 RCV002282710 RCV000148020 RCV002466305 RCV002651581 RCV002651582 RCV002651583 RCV002651586 RCV002642337 RCV000190349 RCV000190350 RCV002791540 RCV002895558 RCV003018891 RCV003224739 RCV003482195 RCV003486380 RCV003780991 RCV003805278 RCV003798738 RCV003800234 RCV003809444 RCV003815555 RCV000022986 RCV000022987 RCV000022988 RCV000022989 RCV000022990 RCV000022991 RCV000022992 RCV000022993 RCV000022994 RCV000022995 RCV000022996 RCV000022997 RCV000795005 RCV000652159 RCV000701663 RCV000797110 RCV000991273 RCV001057504 RCV001066865 RCV001052585 RCV001052005 RCV001235603 RCV001239955
Chronic mucocutaneous candidiasis	Pathogenic	rs2125062092, rs387906759	RCV001667870 RCV000825629
Immunodeficiency 31B	Pathogenic; Likely pathogenic	rs763759889, rs2125048161, rs2124996723, rs1382612689, rs2124996603, rs2125062900, rs2125029430, rs2125075054, rs2125000306, rs587777630, rs2125075036, rs387906758, rs2470533091, rs1417484130, rs1559011859 View all (32 more)	RCV001387601 RCV001824236 RCV002031476 RCV001953772 RCV002046903 RCV001943557 RCV001925332 RCV002003654 RCV001887932 RCV000698604 RCV002246744 RCV000702712 RCV002290424 RCV002651581 RCV002651582 RCV002651583 RCV002651586 RCV002642337 RCV002791540 RCV002895558 RCV003018891 RCV000009611 RCV000009612 RCV000009615 RCV003224739 RCV000280992 RCV003780991 RCV003805278 RCV003798738 RCV003800234 RCV003809444 RCV003815555 RCV003989923 RCV000022985 RCV000688972 RCV000684865 RCV001056331 RCV001383601 RCV001852004 RCV000795005 RCV000652159 RCV000701663 RCV000797110 RCV001057504 RCV001066865 RCV001052585 RCV001052005 RCV001235603 RCV001239955
Inherited Immunodeficiency Diseases	Pathogenic; Likely pathogenic	rs587777630, rs387906763, rs1574636674, rs1574657735, rs1574657762, rs1574672718	RCV001027623 RCV001027626 RCV001027624 RCV001027628 RCV001027625 RCV001027622
Mendelian susceptibility to mycobacterial diseases due to partial STAT1 deficiency	Pathogenic; Likely pathogenic	rs763759889, rs2124996723, rs1382612689, rs2124996603, rs2125062900, rs2125029430, rs2125075054, rs2125000306, rs587777630, rs587777704, rs587777705, rs387906758, rs2470533091, rs1417484130, rs1559011859 View all (30 more)	RCV001387601 RCV002031476 RCV001953772 RCV002046903 RCV001943557 RCV001925332 RCV002003654 RCV001887932 RCV000698604 RCV000144040 RCV000144041 RCV000702712 RCV002290424 RCV002651581 RCV002651582 RCV002651583 RCV002651586 RCV002642337 RCV002791540 RCV002895558 RCV003018891 RCV000009610 RCV000009613 RCV000009614 RCV003224739 RCV003780991 RCV003805278 RCV003798738 RCV003800234 RCV003809444 RCV003815555 RCV000688972 RCV000684865 RCV001056331 RCV001383601 RCV001852004 RCV005416109 RCV000795005 RCV000652159 RCV000701663 RCV000797110 RCV001057504 RCV001066865 RCV001052585 RCV001052005 RCV001235603 RCV001239955
See cases	Pathogenic	rs387906760	RCV003156062
STAT1-related disorder	Pathogenic; Likely pathogenic	rs587777630, rs2470484175, rs387906758, rs387906760	RCV004734695 RCV004527891 RCV004528131 RCV002286565

Show/Hide Unknown Diseases (20)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign; Conflicting classifications of pathogenicity	rs2066797, rs45459703	RCV005921924 RCV005896034
Cervical cancer	Benign; Likely benign	rs2230101	RCV005896029
Cholangiocarcinoma	Benign; Uncertain significance	rs2066797, rs374148252	RCV005921930 RCV005913556
Colon adenocarcinoma	Likely benign	rs200288904	RCV005867046
Colorectal cancer	Likely benign; Uncertain significance	rs200288904, rs1693996687	RCV005867047 RCV005909135
Familial Atypical Mycobacteriosis, Autosomal Dominant	Uncertain significance	rs201656062	RCV000385396
Familial cancer of breast	Likely benign; Benign	rs200288904, rs2230101	RCV005867045 RCV005896027
Hepatocellular carcinoma	Benign; Likely benign	rs2066797, rs138091660	RCV005921925 RCV005896031
Lung cancer	Conflicting classifications of pathogenicity	rs45459703	RCV005896036
Malignant lymphoma, large B-cell, diffuse	Benign	rs2066797	RCV005921927
Malignant tumor of esophagus	Conflicting classifications of pathogenicity; Benign; Likely benign	rs45459703, rs138091660	RCV005896035 RCV005896032
Malignant tumor of urinary bladder	Benign; Likely benign	rs2230101	RCV005896028
Ovarian serous cystadenocarcinoma	Benign	rs41363648	RCV005896026
Sarcoma	Likely benign	rs369780737	RCV005926283
STAT1-Related Immunodeficiency	Conflicting classifications of pathogenicity	rs1574648919	RCV003336192
Thymoma	Benign	rs2066797	RCV005921929
Thyroid cancer, nonmedullary, 1	Benign; Likely benign	rs2230101	RCV005896030
Uterine carcinosarcoma	Benign	rs2066797	RCV005921928
Uterine corpus endometrial carcinoma	Likely benign; Benign	rs200288904, rs45565836, rs138091660	RCV005867048 RCV005909510 RCV005896033
Uveal melanoma	Benign	rs2066797	RCV005921926

Show/Hide Text Mining Associations (367)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Achondroplasia	Associate	19802676
Acquired Immunodeficiency Syndrome	Associate	11675348
Adenocarcinoma Follicular	Associate	35769818
Adenocarcinoma of Lung	Associate	27486982, 34685622, 34773335, 35152527, 37280312
Adenomatous Polyposis Coli	Stimulate	20345984
Agammaglobulinemia	Associate	33133069
Aging Premature	Associate	33450762
AIDS Associated Nephropathy	Associate	26535695
Alopecia Areata	Associate	30558329, 31031313
Alzheimer Disease	Associate	24343863, 28427548, 29848990, 30382187, 32706110, 34312772
Anemia	Associate	24292724, 36105803
Anemia Aplastic	Associate	35590143, 36826612
Anemia Diamond Blackfan	Associate	29745857
Anemia Refractory with Excess of Blasts	Stimulate	11027834
Anodontia	Associate	32641473
Anthrax	Associate	36069176, 37516851
Aortic Aneurysm Abdominal	Associate	21764069, 26045772, 31885343
Aplastic anemia idiopathic	Associate	35590143
Arthritis	Stimulate	16096332
Arthritis Juvenile	Associate	24886659, 29928998
Arthritis Psoriatic	Associate	28052368
Arthritis Rheumatoid	Associate	12905466, 14962955, 16760256, 20604932, 22614743, 27626941, 30483789, 31181818, 32700875, 32840301, 32961930, 33004899, 35941675, 36524113
Arthritis Rheumatoid	Stimulate	21953607, 22401175, 25199798, 27629845
Asthma	Associate	10225979, 20093796, 26092996, 29486764, 40650018
Asthma	Stimulate	10820280
Astrocytoma	Associate	37883975
Atherosclerosis	Associate	25196434, 25478796
Atherosclerosis	Stimulate	39234946
Autism Spectrum Disorder	Associate	34946850
Autoimmune Diseases	Associate	23534974, 27379765, 28139313, 28601685, 30543054, 30878028, 32327459, 32706110, 33679782, 35126392, 36105803
Autoimmune enteropathy	Associate	23534974
Axial Spondyloarthritis	Associate	26671920
Bacterial Infections	Associate	23349666, 37020552
Behcet Syndrome	Associate	33971891
Birt Hogg Dube Syndrome	Associate	33459596
Bone Marrow Failure Disorders	Associate	11520787, 36826612
Brain Neoplasms	Associate	35003395
Breast Neoplasms	Associate	14651776, 15996661, 17695542, 17868458, 22693070, 24475282, 24725474, 24728078, 24825907, 25104439, 27769057, 27791205, 27862996, 28422733, 28465475 View all (14 more)
Breast Neoplasms	Stimulate	7710952
Bronchiectasis	Associate	24343863, 28427548, 30187709, 31068927, 32706110, 33413180
Bronchiolitis Obliterans Syndrome	Associate	37742913
Calcinosis	Stimulate	36281932
Cancer Pain	Associate	26242181
Candidiasis	Associate	23709754, 24343863, 25880788, 26494717, 28139313, 30543054, 33679782, 36102410, 37020552
Candidiasis Chronic Mucocutaneous	Associate	23534974, 23709754, 23796786, 25880788, 26494717, 26604104, 27114460, 27379765, 28597685, 30187709, 30627128, 31068927, 32547544, 32582194, 33413180, 33679782, 34987506, 36105803 View all (3 more)
Candidiasis Oral	Associate	27379765
Carcinogenesis	Associate	23485556, 26156524, 33043814, 35910766
Carcinoma	Associate	25188299
Carcinoma Ductal	Associate	36765396
Carcinoma Hepatocellular	Associate	16987558, 25908103, 27939431, 30264546, 30456450, 30790509, 31827061, 34657877, 38287833, 38604154
Carcinoma Non Small Cell Lung	Associate	17202451, 24274066, 27228072, 30660770, 31627272, 32329850
Carcinoma Ovarian Epithelial	Associate	26657115, 29751820, 33043814, 34790276
Carcinoma Pancreatic Ductal	Associate	39457004
Carcinoma Renal Cell	Associate	17573897, 23741352, 24550497, 34789838, 36281932, 36660930, 36775874, 39871215
Carcinoma Renal Cell	Stimulate	32640276
Carcinoma Squamous Cell	Associate	16470182, 27765924
Cardiomyopathies	Associate	28150292, 39294340
Cardiomyopathy Dilated	Associate	37372424
Carotid Artery Diseases	Associate	25478796
CD59 Deficiency	Associate	23058368, 32661180
Celiac Disease	Associate	12759242, 21288140, 34768815
Chlamydia Infections	Inhibit	17030574
Cholangiocarcinoma	Associate	30886199, 39359389
Chromosome 7 monosomy	Associate	16980411
Chronic recurrent multifocal osteomyelitis	Associate	23585529
Coccidioidomycosis	Associate	31572394
Cognitive Dysfunction	Associate	35863293
Colitis Ulcerative	Associate	11298125, 22467146, 23154639, 29794741, 31918598, 37960728
Colitis Ulcerative	Stimulate	12171960, 20345984
Colonic Neoplasms	Associate	10570189, 19074829, 19476491, 35593226
Colorectal Neoplasms	Associate	17804871, 20098684, 22121102, 23756862, 26676844, 26759270, 27682874, 29061646, 30736824, 36593900, 37931529, 38376276
Colorectal Neoplasms	Stimulate	32275681
Common Variable Immunodeficiency	Associate	33193371
Communicable Diseases	Associate	27114460, 35126392
Congenital disorder of glycosylation type 1A	Associate	35711443
Conjunctival Diseases	Associate	20662656
Continuous Muscle Fiber Activity Hereditary	Associate	9212734
Coronary Artery Disease	Associate	21307941, 25478796
COVID 19	Associate	32549200, 32783921, 33242255, 33991637, 34312772, 34676541, 34757528, 35842705, 37261339, 37261353, 37310504, 37796681, 39940787
COVID 19	Stimulate	33950285, 37936693
Coxa Magna	Associate	38204239
Crohn Disease	Stimulate	12171960
Crohn Disease	Associate	22467146, 23950992, 29556615
Cystic Fibrosis	Associate	12948935, 15107292
Cytokine Release Syndrome	Associate	32549200
Cytomegalovirus Infections	Associate	32603902
Death	Associate	28601685
Delayed Cranial Ossification due to CBFB Haploinsufficiency	Associate	35154120
Dementia	Associate	18003888
Demyelinating Diseases	Associate	19398961
Depressive Disorder	Associate	31779701
Dermatitis	Associate	23534974
Dermatomyositis	Associate	32846838, 33258553, 9212734
Diabetes Mellitus	Associate	28427244, 29417186
Diabetes Mellitus Type 1	Associate	27629486, 32284404, 37164005
Diabetes Mellitus Type 2	Associate	28427244, 32210958, 33562405
Diarrhea	Associate	28623282
Disease	Associate	31665365, 31809599
Down Syndrome	Inhibit	22995210
Down Syndrome	Associate	32572726
Drug Hypersensitivity	Associate	23585528, 7516473
Drug Hypersensitivity	Stimulate	36104109
Drug Related Side Effects and Adverse Reactions	Associate	31554739
Drug Resistant Epilepsy	Associate	28623282
Dupuytren Contracture	Associate	23554969
Dyspnea	Associate	36826612
Ehlers Danlos syndrome type 1	Associate	20648054
Encephalitis Herpes Simplex	Associate	21722947
Encephalitis Viral	Associate	37891420
Endometrial Neoplasms	Associate	32401659
Endometrial Neoplasms	Stimulate	35244291
Enterocolitis Necrotizing	Stimulate	33880370
Eosinophilic Esophagitis	Inhibit	21694534
Eosinophilic Esophagitis	Associate	35126392
Erythema	Associate	34987506
Escherichia coli Infections	Associate	31296484
Esophageal Neoplasms	Associate	30506884, 35107757
Esophageal Squamous Cell Carcinoma	Associate	22631645, 25355139, 25438156, 28981100, 29855346
Esophagitis	Associate	32547544
Familial Primary Pulmonary Hypertension	Associate	36899621
Fanconi Anemia	Associate	23585528
Fasciitis	Associate	34381187
Fibrocartilaginous embolism	Associate	34676010
Fibrosarcoma	Associate	15883164
Fibrosis	Associate	18322232, 33454903
Gallbladder Diseases	Associate	35035811
Gallbladder Neoplasms	Associate	30886199, 35035811
GATA2 Deficiency	Associate	29111217
Gaucher Disease	Inhibit	29317695
Genetic Diseases Inborn	Associate	34987506
Giant Cell Arteritis	Associate	26698852
Giant Cell Tumor of Bone	Associate	29651441
Glioblastoma	Associate	18225539, 22242177, 23250732, 33104022, 33652086, 36834974, 38287522
Glioma	Associate	19423540, 32181805, 34784299, 36980858
Glut1 Deficiency Syndrome	Associate	19103208, 20568281
Graft vs Host Disease	Associate	28601685
Granulocytopenia with Immunoglobulin Abnormality	Associate	33413180
Granuloma	Associate	19464956
Granulosa cell tumor of the ovary	Associate	29651441
Graves Disease	Associate	33367784
Graves Ophthalmopathy	Associate	24924312, 39619202
Growth Disorders	Associate	33413180
Hashimoto Disease	Associate	32603365
Head and Neck Neoplasms	Associate	21207025, 23363816, 25972070, 38231444
Heart Arrest	Associate	9531615
Hemorrhage	Associate	30543054
Hepatic Encephalopathy	Associate	34938356
Hepatitis C	Associate	14690454, 21898483
Hepatitis C	Stimulate	17804510
Hepatitis C	Inhibit	24955730
Hepatitis C Chronic	Associate	14690454
Hereditary Breast and Ovarian Cancer Syndrome	Associate	12032322
Hereditary leiomyomatosis and renal cell cancer	Associate	12393683
Herpes Simplex	Associate	32547544, 34552595
HIV Infections	Associate	19103208, 19299650, 30026298, 32053234, 38005838
HIV Infections	Stimulate	28623917
Hodgkin Disease	Associate	28791394
Hypercalcemia	Associate	19464956
Hypergammaglobulinemia	Associate	26162572
Hyperplasia	Stimulate	11477536, 16470182
Hypersensitivity	Stimulate	7516473
Hypersensitivity Immediate	Associate	16965632
Hyperthyroidism	Associate	37876543
Hypoxia	Associate	25188299, 26045772, 32981207
Hypoxia Brain	Associate	31034990
Ichthyosis Lamellar	Associate	32544098
IgA Vasculitis	Associate	12905466
IgA Vasculitis	Inhibit	40590520
Immune Dysregulation Polyendocrinopathy Enteropathy X Linked Syndrome	Associate	23534974, 25349174, 33679782, 33864888
Immune System Diseases	Associate	35126392, 36105803, 36826612, 37020552
Immunologic Deficiency Syndromes	Associate	22195034, 26494717, 26604104, 28139313, 30483789, 31068927, 32603902, 33679782, 36069176
Infections	Inhibit	11673534
Infections	Associate	19651857, 20395558, 21439068, 23349666, 28139313, 28601685, 31296484, 32603902, 32706110, 33193365, 35248104, 36102410, 36105803, 37377442
Inflammation	Associate	10225979, 11673534, 12171960, 12759242, 12807916, 18003888, 19103208, 20345984, 20683900, 22401175, 22693070, 23592500, 23922745, 24039874, 24292724 View all (39 more)
Inflammation	Stimulate	27769057
Inflammatory Bowel Diseases	Associate	12171960, 32661180, 35655783
Influenza Human	Stimulate	24641803, 30224514
Influenza Human	Associate	33193365, 37108410
Interferon gamma receptor 1 deficiency	Associate	37277724
Intracranial Aneurysm	Associate	23534974, 23709754, 27114460
Intrahepatic Cholestasis of Pregnancy	Associate	35643225
Invasive Pneumococcal Disease Recurrent Isolated 2	Associate	23534974, 23585529, 36069176, 37516851
Ischemia	Associate	22034635
Job Syndrome	Associate	23796786, 25880788
Keloid	Associate	33450762
Kidney Diseases	Associate	29567951
Kidney Neoplasms	Associate	20624457
Leishmaniasis	Associate	36102410
Leishmaniasis Visceral	Associate	36102410
Leukemia	Associate	21224412, 37549179, 8642285, 9657745
Leukemia Biphenotypic Acute	Associate	25193702
Leukemia Large Granular Lymphocytic	Associate	28736298, 29474442
Leukemia Lymphocytic Chronic B Cell	Associate	12586635, 12855573, 16517754, 18182577, 23349394, 23936412, 30498085, 36104109, 9166857
Leukemia Lymphoma Adult T Cell	Stimulate	26025667
Leukemia Megakaryoblastic Acute	Associate	28546428
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	26460262
Leukemia Myeloid Acute	Associate	11027834, 23825585, 8634413, 8704235, 9694725
Leukemia Myelomonocytic Acute	Associate	37549179
Leukemia Promyelocytic Acute	Associate	12393712
Leukemia T Cell	Associate	24223100
Li Fraumeni Syndrome	Associate	34943910
Lichen Planus	Associate	31554739
Liver Cirrhosis Biliary	Associate	28425483, 36773569
Liver Neoplasms	Associate	34763315
Lung Neoplasms	Associate	24833526, 26351076, 34685622, 35910766
Lupus Erythematosus Cutaneous	Associate	34081040, 36212172
Lupus Erythematosus Discoid	Associate	26568320, 36212172
Lupus Erythematosus Systemic	Associate	17469140, 19019891, 19333953, 19404947, 23199328, 23623029, 24460726, 26968426, 27114460, 27257790, 28039018, 29257335, 29912393, 30674474, 31790472 View all (6 more)
Lupus Erythematosus Systemic	Stimulate	18803832, 24292724, 24451065, 33037080
Lupus Nephritis	Stimulate	23199328
Lymphatic Metastasis	Associate	35821222
Lymphohistiocytosis Hemophagocytic	Associate	28601685, 32603902
Lymphoma	Associate	21418178, 29504848, 9531615
Lymphoma B Cell	Stimulate	12933571
Lymphoma Large B Cell Diffuse	Associate	23487038
Lymphoma Large Cell Anaplastic	Associate	31804622
Lymphoma Non Hodgkin	Associate	21063024
Lymphoma T Cell	Associate	26268241
Lymphoma T Cell Cutaneous	Associate	21036138, 9427711
Macular Degeneration	Associate	38067097
Melanoma	Stimulate	10072444
Melanoma	Associate	15009724, 15668815, 16169484, 18596671, 19396596, 19723881, 20103601, 20398276, 20500769, 25690042, 31216116, 9353349
Melanoma	Inhibit	17488182
Meningioma	Associate	36203966
Mesothelioma Malignant	Associate	27987139, 33300108
Mevalonate Kinase Deficiency	Associate	30030262
Microsatellite Instability	Associate	32275681
Mitochondrial Diseases	Associate	37236195
Mouth Diseases	Associate	26242181
Mouth Neoplasms	Associate	34500779
Mucocutaneous Lymph Node Syndrome	Inhibit	40590520
Mucormycosis	Associate	24709374
Multiple Myeloma	Associate	17201122, 17363736, 22838736, 25781885, 32844992, 34327809, 35760800, 36867577
Multiple Pterygium Syndrome Autosomal Dominant	Associate	28597685
Multiple Sclerosis	Associate	18200504, 19398961, 24586361, 31004050, 39985494
Muscle Weakness	Associate	36826612
Muscular Dystrophy Duchenne	Associate	36619896
Mycobacterium Infections Nontuberculous	Associate	11909852
Mycoses	Associate	23534974, 23796786
Myelodysplastic Syndromes	Associate	11027834
Myocardial Infarction	Associate	29381915, 36553589
Myocarditis	Associate	37020552
Myopathies Structural Congenital	Associate	34220848
Myopathy Central Core	Associate	24343863
Myositis	Associate	25098831, 9212734
Myotonic Dystrophy	Associate	34580642
Nasopharyngeal Carcinoma	Associate	11222718, 12865928, 36061358, 36310139, 37023940
Nasopharyngeal Neoplasms	Associate	10929762
Necrosis	Associate	27769057, 9212734
Neointima	Associate	24768588
Neoplasm Metastasis	Associate	20500769, 21964766, 24728078, 27486982, 31113461, 35152527, 36929425, 37023940
Neoplasms	Inhibit	10929762, 15217838, 23950841, 24274066, 25438156, 25690042, 28981100, 29855346, 30886199, 9630226
Neoplasms	Associate	11222718, 11909852, 12393683, 15668815, 17559122, 17868458, 18225539, 18419622, 19495772, 20098684, 21338529, 22235336, 22242177, 22482967, 23487038 View all (58 more)
Neoplasms Cystic Mucinous and Serous	Associate	33043814
Neoplasms Germ Cell and Embryonal	Associate	12942126
Neoplasms Squamous Cell	Associate	17559122, 23534974, 34081040
Nephrotic Syndrome	Associate	22252769
Nerve Degeneration	Associate	32981207
Neuralgia	Associate	34741226
Neuroblastoma	Associate	16886176
Neurodegenerative Diseases	Associate	32981207, 34312772
Neuroendocrine Tumors	Associate	36307579
Neuroinflammatory Diseases	Associate	19103208
Neuromyelitis Optica	Associate	22036215
Non Muscle Invasive Bladder Neoplasms	Associate	39986350
Nonsyndromic Holoprosencephaly	Associate	28427548
Oculocutaneous albinism type 2	Stimulate	23250732
Opportunistic Infections	Associate	32327459
Oral Ulcer	Associate	36826612
Organizing Pneumonia	Associate	31068927
Osteitis Deformans	Associate	19556344
Osteoarthritis	Associate	30483789, 31886203
Osteolysis	Associate	34710525
Osteomyelitis	Associate	39849463
Osteoporosis	Associate	19594299, 23329517, 25563300
Osteoporotic Fractures	Stimulate	25563300
Ovarian Neoplasms	Associate	15726096, 25826225, 26497667, 28536310, 29751820, 33043814, 33177242, 34626802, 34660776, 34790276, 35820543, 37151134
Ovarian Neoplasms	Stimulate	20576130
Pallor	Associate	36826612
Pancreatic Neoplasms	Associate	21321110, 22537161, 23426533, 29596435, 31548328, 32925750, 33098056
Paracoccidioidomycosis	Associate	31572394
Parkinson Disease	Associate	18197754, 34312772, 36952070
Penile Neoplasms	Associate	28751665
Penttinen Aula syndrome	Associate	33450762, 35689379
Periodontal Diseases	Associate	22995210
Plaque Atherosclerotic	Associate	25196434
Platelet Signal Processing Defect	Inhibit	37516851
Pneumonia	Associate	27379765, 32327459, 34987506
Pneumothorax	Associate	16965632
Polycythemia Vera	Associate	21074499, 26491227
Polyendocrinopathies Autoimmune	Associate	23534974
Polymyositis	Associate	9212734
Polyradiculoneuropathy Chronic Inflammatory Demyelinating	Associate	19398961
Post Acute COVID 19 Syndrome	Associate	36890149, 39940787
Pouchitis	Associate	11298125
Pre Eclampsia	Associate	21075447
Primary Immunodeficiency Diseases	Associate	19436109, 24709374, 26162572, 32582194, 32603902
Primary Myelofibrosis	Associate	32331228
Prostatic Neoplasms	Associate	20053773, 24886089, 26495772, 28622443, 34622927, 35908276, 36899018
Prostatic Neoplasms Castration Resistant	Associate	35127252
Prostatitis	Associate	28622443
Proteinuria	Associate	32354727
Psoriasis	Associate	20555352, 36497125, 38115636, 8823363
Psychotic Disorders	Inhibit	30503835
Pulmonary Arterial Hypertension	Stimulate	34133010
Pulmonary Disease Chronic Obstructive	Associate	20395558, 20562129, 23877858
Pulpitis	Associate	33777260
Purpura Thrombocytopenic Idiopathic	Associate	25707685
Rectal Neoplasms	Associate	22121102, 35603163
Red Cell Aplasia Pure	Associate	36105803
Renal Insufficiency	Associate	28601685
Respiratory Distress Syndrome	Associate	16689659, 33149247, 34418997
Respiratory Tract Infections	Associate	30187709, 33679782, 36105803
Rosacea	Associate	34290700, 34987506
Sarcoidosis	Associate	19464956, 20662656, 24768588
Sarcoma Ewing	Associate	30131449
Sarcoma Kaposi	Associate	37883374
Schizophrenia	Associate	29449061, 33562405
Severe Acute Respiratory Syndrome	Stimulate	37261339
Sjogren's Syndrome	Associate	17075845, 25113744, 25736842, 29504848, 29604049, 29655283
Skin Manifestations	Associate	32572726, 37020552
Small Cell Lung Carcinoma	Associate	29020964
Smooth Muscle Tumor	Associate	36281932
Spinocerebellar Ataxia 17	Associate	25880788
Squamous Cell Carcinoma of Head and Neck	Associate	17559122, 19596857, 21207025, 30610792, 32012175, 32012401, 32319563, 36328378, 36515567, 36929425, 37185662, 38166970, 38231444
Squamous Cell Carcinoma of Head and Neck	Stimulate	20702412
Status Asthmaticus	Stimulate	10225979, 27836955
Status Asthmaticus	Associate	20093796, 37249291
Stomach Neoplasms	Associate	22325465, 23704922, 26242264, 31113461, 32867271, 34159686, 35821222, 36353796, 9769120
Stomatitis Aphthous	Associate	21805152, 32547544, 34649540
Substance Related Disorders	Stimulate	31804622
Sutton disease 2	Associate	34649540
Synovitis	Associate	7500028
Systemic Vasculitis	Associate	28440408
talaromycosis	Associate	31572394, 33894704
Tertiary Lymphoid Structures	Associate	17559122
Testicular Neoplasms	Associate	30588194
Thanatophoric Dysplasia	Associate	9582336
Thrombocythemia Essential	Associate	21074499, 26491227
Thrombotic Microangiopathies	Associate	32208488
Thymoma	Associate	10886240
Thyroid Cancer Papillary	Associate	32964981, 35366462
Thyroid Carcinoma Anaplastic	Associate	32554601, 35769818
Thyroid Neoplasms	Associate	35769818
Tinea	Associate	26494717
Triple Negative Breast Neoplasms	Associate	23443971, 24390667, 29750542, 29933930, 31921107, 33251982
Tuberculosis	Associate	34710525, 37340462, 37460564, 39391304
Tuberculosis Meningeal	Inhibit	36773569
Tuberculosis Meningeal	Associate	38288122
Tuberculosis Multidrug Resistant	Associate	37340462
Tuberculosis Pulmonary	Associate	31756428, 37460564
Tuberculosis Spinal	Associate	36773569, 37340462
Ulcer	Associate	32547544
Urinary Bladder Neoplasms	Associate	17617740, 32420368, 33608980, 35685866, 39986350
Uterine Cervical Dysplasia	Associate	34670303
Uterine Cervical Neoplasms	Associate	29048616, 31099286, 31242951, 34642300
Uterine Diseases	Associate	32761670
Uveal melanoma	Associate	31025552, 35163491
Varicocele	Associate	26209830
Vascular Diseases	Associate	20568281, 25196434, 35126392
Venous Malformations Multiple Cutaneous and Mucosal	Associate	18401423
Virus Diseases	Associate	18003888, 19103208, 19436109, 20568281, 21772053, 23534974, 32603902, 37020552
Virus Diseases	Stimulate	33193365
Wasting Syndrome	Associate	33450762
Wilms Tumor	Associate	20624457
X Linked Combined Immunodeficiency Diseases	Associate	27379765, 28601685, 30543054, 32691468, 33679782, 36105803
Young Syndrome	Associate	28427548

STAT1 (signal transducer and activator of transcription 1)