Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
677
Gene name Gene Name - the full gene name approved by the HGNC.
ZFP36 ring finger protein like 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZFP36L1
Synonyms (NCBI Gene) Gene synonyms aliases
BRF1, Berg36, ERF-1, ERF1, RNF162B, TIS11B, cMG1
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q24.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the TIS11 family of early response genes, which are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. This gene is well conserved across species and has a promoter that contains motifs seen
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004957 hsa-let-7a-5p qRT-PCR 17942906
MIRT004941 hsa-miR-98-5p qRT-PCR 17942906
MIRT038046 hsa-miR-423-5p CLASH 23622248
MIRT725051 hsa-miR-3614-3p HITS-CLIP 19536157
MIRT191603 hsa-miR-6734-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade IDA 18326031, 20166898
GO:0000165 Process MAPK cascade IEA
GO:0000288 Process Nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay IEA
GO:0000932 Component P-body IDA 17369404
GO:0000932 Component P-body IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601064 1107 ENSG00000185650
Protein
UniProt ID Q07352
Protein name mRNA decay activator protein ZFP36L1 (Butyrate response factor 1) (EGF-response factor 1) (ERF-1) (TPA-induced sequence 11b) (Zinc finger protein 36, C3H1 type-like 1) (ZFP36-like 1)
Protein function Zinc-finger RNA-binding protein that destabilizes several cytoplasmic AU-rich element (ARE)-containing mRNA transcripts by promoting their poly(A) tail removal or deadenylation, and hence provide a mechanism for attenuating protein synthesis (Pu
PDB 1W0V , 1W0W
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04553 Tis11B_N 1 106 Tis11B like protein, N terminus Family
PF00642 zf-CCCH 115 141 Zinc finger C-x8-C-x5-C-x3-H type (and similar) Family
PF00642 zf-CCCH 153 178 Zinc finger C-x8-C-x5-C-x3-H type (and similar) Family
Tissue specificity TISSUE SPECIFICITY: Expressed mainly in the basal epidermal layer, weakly in the suprabasal epidermal layers (PubMed:27182009). Expressed in epidermal keratinocytes (at protein level) (PubMed:27182009). Expressed in osteoblasts (PubMed:15465005). {ECO:000
Sequence
MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSS
KFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPG
GGQVNSSRYKTELC
RPFEENGACKYGDKCQFAHGI
HELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAE
ERRALAGARDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPILSADDLLGS
PTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLS
DQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD
Sequence length 338
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cellular senescence   Butyrate Response Factor 1 (BRF1) binds and destabilizes mRNA
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma N/A N/A GWAS
Celiac disease Celiac disease N/A N/A GWAS
Crohn Disease Crohn's disease N/A N/A GWAS
Hypertension Hypertension (confirmatory factor analysis Factor 12) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Inhibit 37801008
Anemia Aplastic Associate 29993187
Arthritis Rheumatoid Associate 32723749
Autoimmune Diseases Associate 26616563
Breast Neoplasms Associate 17855657
Carcinoma Ovarian Epithelial Associate 24190013
Carcinoma Renal Cell Associate 19801654
Carcinoma Small Cell Associate 36008402
Celiac Disease Associate 26859134
Glioblastoma Associate 31999936