Gene Gene information from NCBI Gene database.
Entrez ID 677
Gene name ZFP36 ring finger protein like 1
Gene symbol ZFP36L1
Synonyms (NCBI Gene)
BRF1Berg36ERF-1ERF1RNF162BTIS11BcMG1
Chromosome 14
Chromosome location 14q24.1
Summary This gene is a member of the TIS11 family of early response genes, which are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. This gene is well conserved across species and has a promoter that contains motifs seen
miRNA miRNA information provided by mirtarbase database.
1504
miRTarBase ID miRNA Experiments Reference
MIRT004957 hsa-let-7a-5p qRT-PCR 17942906
MIRT004941 hsa-miR-98-5p qRT-PCR 17942906
MIRT038046 hsa-miR-423-5p CLASH 23622248
MIRT725051 hsa-miR-3614-3p HITS-CLIP 19536157
MIRT191603 hsa-miR-6734-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
91
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade IDA 18326031, 20166898
GO:0000165 Process MAPK cascade IEA
GO:0000288 Process Nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay IEA
GO:0000932 Component P-body IDA 17369404
GO:0000932 Component P-body IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601064 1107 ENSG00000185650
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q07352
Protein name mRNA decay activator protein ZFP36L1 (Butyrate response factor 1) (EGF-response factor 1) (ERF-1) (TPA-induced sequence 11b) (Zinc finger protein 36, C3H1 type-like 1) (ZFP36-like 1)
Protein function Zinc-finger RNA-binding protein that destabilizes several cytoplasmic AU-rich element (ARE)-containing mRNA transcripts by promoting their poly(A) tail removal or deadenylation, and hence provide a mechanism for attenuating protein synthesis (Pu
PDB 1W0V , 1W0W
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04553 Tis11B_N 1 106 Tis11B like protein, N terminus Family
PF00642 zf-CCCH 115 141 Zinc finger C-x8-C-x5-C-x3-H type (and similar) Family
PF00642 zf-CCCH 153 178 Zinc finger C-x8-C-x5-C-x3-H type (and similar) Family
Tissue specificity TISSUE SPECIFICITY: Expressed mainly in the basal epidermal layer, weakly in the suprabasal epidermal layers (PubMed:27182009). Expressed in epidermal keratinocytes (at protein level) (PubMed:27182009). Expressed in osteoblasts (PubMed:15465005). {ECO:000
Sequence
MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSS
KFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPG
GGQVNSSRYKTELC
RPFEENGACKYGDKCQFAHGI
HELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAE
ERRALAGARDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPILSADDLLGS
PTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLS
DQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD
Sequence length 338
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cellular senescence   Butyrate Response Factor 1 (BRF1) binds and destabilizes mRNA