Gene Gene information from NCBI Gene database.
Entrez ID 6767
Gene name ST13 Hsp70 interacting protein
Gene symbol ST13
Synonyms (NCBI Gene)
AAG2FAM10A1FAM10A4HIPHOPHSPABPHSPABP1P48PRO0786SNC6
Chromosome 22
Chromosome location 22q13.2
Summary The protein encoded by this gene is an adaptor protein that mediates the association of the heat shock proteins HSP70 and HSP90. This protein has been shown to be involved in the assembly process of glucocorticoid receptor, which requires the assistance o
miRNA miRNA information provided by mirtarbase database.
409
miRTarBase ID miRNA Experiments Reference
MIRT052020 hsa-let-7b-5p CLASH 23622248
MIRT047118 hsa-miR-183-5p CLASH 23622248
MIRT045078 hsa-miR-186-5p CLASH 23622248
MIRT437527 hsa-miR-19b-3p Immunoprecipitaion 22382630
MIRT520920 hsa-miR-21-3p PAR-CLIP 23446348
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21163940, 25959826, 32814053
GO:0005737 Component Cytoplasm IEA
GO:0005737 Component Cytoplasm TAS 8721986
GO:0005829 Component Cytosol IDA
GO:0006457 Process Protein folding IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606796 11343 ENSG00000100380
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P50502
Protein name Hsc70-interacting protein (Hip) (Aging-associated protein 2) (Progesterone receptor-associated p48 protein) (Protein FAM10A1) (Putative tumor suppressor ST13) (Renal carcinoma antigen NY-REN-33) (Suppression of tumorigenicity 13 protein)
Protein function One HIP oligomer binds the ATPase domains of at least two HSC70 molecules dependent on activation of the HSC70 ATPase by HSP40. Stabilizes the ADP state of HSC70 that has a high affinity for substrate protein. Through its own chaperone activity,
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18253 HipN 2 43 Hsp70-interacting protein N N-terminal domain Domain
PF17830 STI1 310 363 STI1 domain Domain
Sequence
MDPRKVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPPATQKAKSEENTKEEKP
DSKKVEEDLKADEPSSEESDLEIDKEGVIEPDTDAPQEMGDENAEITEEMMDQANDKKVA
AIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPD
SAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLKEVQPRAQKIAEHRRKYER
KREEREIKERIERVKKAREEHERAQREEEARRQSGAQYGSFPGGFPGGMPGNFPGGMPGM
GGGMPGMAGMPGLNEILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKYQSNPKVMNLISK
LSA
KFGGQA
Sequence length 369
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Regulation of HSF1-mediated heat shock response
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
INSOMNIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Adenocarcinoma Associate 15637739
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of Lung Associate 35029906
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Associate 24376685, 27334118
★☆☆☆☆
Found in Text Mining only
Carcinoma Intraductal Noninfiltrating Associate 22887771
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Associate 15637739, 16358374, 34890713
★☆☆☆☆
Found in Text Mining only
Drug Related Side Effects and Adverse Reactions Associate 17215369
★☆☆☆☆
Found in Text Mining only
Laryngeal Neoplasms Associate 32791689
★☆☆☆☆
Found in Text Mining only
Lung Neoplasms Associate 28232384
★☆☆☆☆
Found in Text Mining only
Melanoma Associate 14726712
★☆☆☆☆
Found in Text Mining only
Neoplasms Inhibit 16358374, 27334118
★☆☆☆☆
Found in Text Mining only