Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6754
Gene name Gene Name - the full gene name approved by the HGNC.	Somatostatin receptor 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SSTR4
Synonyms (NCBI Gene) Gene synonyms aliases	SS-4-R, SS4-R, SS4R, SST4
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20p11.21
Summary Summary of gene provided in NCBI Entrez Gene.	Somatostatin acts at many sites to inhibit the release of many hormones and other secretory proteins. The biologic effects of somatostatin are probably mediated by a family of G protein-coupled receptors that are expressed in a tissue-specific manner. S

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004994	Function	Somatostatin receptor activity	IBA
GO:0004994	Function	Somatostatin receptor activity	IEA
GO:0004994	Function	Somatostatin receptor activity	TAS	9892014
GO:0005515	Function	Protein binding	IPI	19426801
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8100352
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	9892014
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	8405411
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	9892014
GO:0016020	Component	Membrane	IEA
GO:0038170	Process	Somatostatin signaling pathway	IEA
GO:0042923	Function	Neuropeptide binding	IBA
GO:0043005	Component	Neuron projection	IBA
GO:0071385	Process	Cellular response to glucocorticoid stimulus	IBA

MIM	HGNC	e!Ensembl
182454	11333	ENSG00000132671

Protein

UniProt ID

P31391

Protein name

Somatostatin receptor type 4 (SS-4-R) (SS4-R) (SS4R) (SST4)

Protein function

Receptor for somatostatin-14. The activity of this receptor is mediated by G proteins which inhibits adenylyl cyclase. It is functionally coupled not only to inhibition of adenylate cyclase, but also to activation of both arachidonate release an

PDB

7XMS , 7XMT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	64 → 311	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Specifically expressed in fetal and adult brain, lung tissue, stomach, and in lesser quantities in the kidney, pituitary and adrenals.

Sequence

MSAPSTLPPGGEEGLGTAWPSAANASSAPAEAEEAVAGPGDARAAGMVAIQCIYALVCLV
GLVGNALVIFVILRYAKMKTATNIYLLNLAVADELFMLSVPFVASSAALRHWPFGSVLCR
AVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLP
IAIFADTRPARGGQAVACNLQWPHPAWSAVFVVYTFLLGFLLPVLAIGLCYLLIVGKMRA
VALRAGWQQRRRSEKKITRLVLMVVVVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILS
YANSCANPILYGFLSDNFRRFFQRVLCLRCCLLEGAGGAEEEPLDYYATALKSKGGAGCM
CPPLPCQQEALQPEPGRKRIPLTRTTTF

Sequence length

388

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Hormone signaling		Peptide ligand-binding receptors G alpha (i) signalling events

SSTR4 (somatostatin receptor 4)