Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6751
Gene name Gene Name - the full gene name approved by the HGNC.	Somatostatin receptor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SSTR1
Synonyms (NCBI Gene) Gene synonyms aliases	SRIF-2, SS-1-R, SS1-R, SS1R, SST1
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q21.1
Summary Summary of gene provided in NCBI Entrez Gene.	Somatostatins are peptide hormones that regulate diverse cellular functions such as neurotransmission, cell proliferation, and endocrine signaling as well as inhibiting the release of many hormones and other secretory proteins. Somatostatin has two active

Show/Hide all(134)

miRTarBase ID	miRNA	Experiments	Reference
MIRT484403	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT484402	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT484400	hsa-miR-4285	PAR-CLIP	20371350
MIRT484401	hsa-miR-4767	PAR-CLIP	20371350
MIRT484399	hsa-miR-4467	PAR-CLIP	20371350
MIRT484398	hsa-miR-8089	PAR-CLIP	20371350
MIRT490694	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT490693	hsa-miR-4436b-3p	PAR-CLIP	23592263
MIRT490692	hsa-miR-4632-5p	PAR-CLIP	23592263
MIRT490691	hsa-miR-6735-5p	PAR-CLIP	23592263
MIRT490690	hsa-miR-6879-5p	PAR-CLIP	23592263
MIRT490689	hsa-miR-7843-5p	PAR-CLIP	23592263
MIRT484403	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT484402	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT490688	hsa-miR-501-3p	PAR-CLIP	23592263
MIRT490687	hsa-miR-502-3p	PAR-CLIP	23592263
MIRT484400	hsa-miR-4285	PAR-CLIP	23592263
MIRT490686	hsa-miR-3616-3p	PAR-CLIP	23592263
MIRT484401	hsa-miR-4767	PAR-CLIP	23592263
MIRT490685	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT490684	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT484399	hsa-miR-4467	PAR-CLIP	23592263
MIRT490683	hsa-miR-3153	PAR-CLIP	23592263
MIRT490682	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT490681	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT490680	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT490679	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT490678	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT490677	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT490676	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT490675	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT484398	hsa-miR-8089	PAR-CLIP	23592263
MIRT484403	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT484402	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT484400	hsa-miR-4285	PAR-CLIP	23592263
MIRT484401	hsa-miR-4767	PAR-CLIP	23592263
MIRT484399	hsa-miR-4467	PAR-CLIP	23592263
MIRT484398	hsa-miR-8089	PAR-CLIP	23592263
MIRT484403	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT484402	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT484400	hsa-miR-4285	PAR-CLIP	20371350
MIRT484401	hsa-miR-4767	PAR-CLIP	20371350
MIRT484399	hsa-miR-4467	PAR-CLIP	20371350
MIRT484398	hsa-miR-8089	PAR-CLIP	20371350
MIRT490694	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT490693	hsa-miR-4436b-3p	PAR-CLIP	23592263
MIRT490692	hsa-miR-4632-5p	PAR-CLIP	23592263
MIRT490691	hsa-miR-6735-5p	PAR-CLIP	23592263
MIRT490690	hsa-miR-6879-5p	PAR-CLIP	23592263
MIRT490689	hsa-miR-7843-5p	PAR-CLIP	23592263
MIRT484403	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT484402	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT490688	hsa-miR-501-3p	PAR-CLIP	23592263
MIRT490687	hsa-miR-502-3p	PAR-CLIP	23592263
MIRT484400	hsa-miR-4285	PAR-CLIP	23592263
MIRT490686	hsa-miR-3616-3p	PAR-CLIP	23592263
MIRT484401	hsa-miR-4767	PAR-CLIP	23592263
MIRT490685	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT490684	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT484399	hsa-miR-4467	PAR-CLIP	23592263
MIRT490683	hsa-miR-3153	PAR-CLIP	23592263
MIRT490682	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT490681	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT490680	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT490679	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT490678	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT490677	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT490676	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT490675	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT484398	hsa-miR-8089	PAR-CLIP	23592263
MIRT484403	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT484402	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT484400	hsa-miR-4285	PAR-CLIP	23592263
MIRT484401	hsa-miR-4767	PAR-CLIP	23592263
MIRT484399	hsa-miR-4467	PAR-CLIP	23592263
MIRT484398	hsa-miR-8089	PAR-CLIP	23592263
MIRT1392815	hsa-miR-1228	CLIP-seq
MIRT1392816	hsa-miR-342-3p	CLIP-seq
MIRT1392817	hsa-miR-3920	CLIP-seq
MIRT1392818	hsa-miR-3940-5p	CLIP-seq
MIRT1392819	hsa-miR-3942-5p	CLIP-seq
MIRT1392820	hsa-miR-4326	CLIP-seq
MIRT1392821	hsa-miR-4422	CLIP-seq
MIRT1392822	hsa-miR-4507	CLIP-seq
MIRT1392823	hsa-miR-4691-5p	CLIP-seq
MIRT1392824	hsa-miR-4700-3p	CLIP-seq
MIRT1392825	hsa-miR-4703-5p	CLIP-seq
MIRT1392826	hsa-miR-4762-3p	CLIP-seq
MIRT1392827	hsa-miR-578	CLIP-seq
MIRT1392828	hsa-miR-635	CLIP-seq
MIRT2117888	hsa-miR-1908	CLIP-seq
MIRT2117889	hsa-miR-1915	CLIP-seq
MIRT2117890	hsa-miR-3613-3p	CLIP-seq
MIRT2117891	hsa-miR-361-3p	CLIP-seq
MIRT2117892	hsa-miR-4707-3p	CLIP-seq
MIRT2117893	hsa-miR-4766-5p	CLIP-seq
MIRT2117894	hsa-miR-663	CLIP-seq
MIRT2339839	hsa-miR-1185	CLIP-seq
MIRT2339840	hsa-miR-1262	CLIP-seq
MIRT2339841	hsa-miR-1292	CLIP-seq
MIRT2339842	hsa-miR-1293	CLIP-seq
MIRT2339843	hsa-miR-2115	CLIP-seq
MIRT2339844	hsa-miR-3155	CLIP-seq
MIRT2339845	hsa-miR-3155b	CLIP-seq
MIRT2339846	hsa-miR-3158-3p	CLIP-seq
MIRT2339847	hsa-miR-3679-5p	CLIP-seq
MIRT2339848	hsa-miR-4259	CLIP-seq
MIRT2339849	hsa-miR-4471	CLIP-seq
MIRT2339850	hsa-miR-4483	CLIP-seq
MIRT2339851	hsa-miR-4701-3p	CLIP-seq
MIRT2339852	hsa-miR-4703-3p	CLIP-seq
MIRT2339853	hsa-miR-4715-5p	CLIP-seq
MIRT2339854	hsa-miR-4721	CLIP-seq
MIRT2339855	hsa-miR-484	CLIP-seq
MIRT2339856	hsa-miR-508-5p	CLIP-seq
MIRT2339857	hsa-miR-767-3p	CLIP-seq
MIRT2433573	hsa-miR-149	CLIP-seq
MIRT2433574	hsa-miR-2054	CLIP-seq
MIRT2433575	hsa-miR-3064-5p	CLIP-seq
MIRT2433576	hsa-miR-3065-5p	CLIP-seq
MIRT2433577	hsa-miR-3613-5p	CLIP-seq
MIRT2433578	hsa-miR-374c	CLIP-seq
MIRT2433579	hsa-miR-3925-3p	CLIP-seq
MIRT2433580	hsa-miR-4445	CLIP-seq
MIRT2433581	hsa-miR-4794	CLIP-seq
MIRT2433582	hsa-miR-495	CLIP-seq
MIRT2433583	hsa-miR-655	CLIP-seq
MIRT2433584	hsa-miR-766	CLIP-seq
MIRT2460573	hsa-miR-3919	CLIP-seq
MIRT2460574	hsa-miR-642b	CLIP-seq
MIRT2460573	hsa-miR-3919	CLIP-seq
MIRT2633772	hsa-miR-4489	CLIP-seq
MIRT2460573	hsa-miR-3919	CLIP-seq
MIRT2633772	hsa-miR-4489	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
EZH2	Repression	22144423

Show/Hide all(30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004994	Function	Somatostatin receptor activity	IBA
GO:0004994	Function	Somatostatin receptor activity	IDA	1346068
GO:0004994	Function	Somatostatin receptor activity	IEA
GO:0004994	Function	Somatostatin receptor activity	TAS	8405411
GO:0005515	Function	Protein binding	IPI	15247250
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	8405411
GO:0007215	Process	Glutamate receptor signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	9886848
GO:0016020	Component	Membrane	IEA
GO:0021549	Process	Cerebellum development	IEA
GO:0030900	Process	Forebrain development	IEA
GO:0038170	Process	Somatostatin signaling pathway	IEA
GO:0042594	Process	Response to starvation	IEA
GO:0042923	Function	Neuropeptide binding	IBA
GO:0043005	Component	Neuron projection	IBA
GO:0071392	Process	Cellular response to estradiol stimulus	IBA
GO:0071392	Process	Cellular response to estradiol stimulus	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA

MIM	HGNC	e!Ensembl
182451	11330	ENSG00000139874

Protein

UniProt ID

P30872

Protein name

Somatostatin receptor type 1 (SS-1-R) (SS1-R) (SS1R) (SST1) (SRIF-2)

Protein function

Receptor for somatostatin with higher affinity for somatostatin-14 than -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase. In addition it stimulates phosphotyrosine phosphatase and Na(+)/H(+

PDB

8XIO , 8XIP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	75 → 323	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Fetal kidney, fetal liver, and adult pancreas, brain, lung, jejunum and stomach.

Sequence

MFPNGTASSPSSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAIL
ISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLL
RHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLG
VWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAIC
LCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD
DATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKS
RAYSVEDFQPENLESGGVFRNGTCTSRITTL

Sequence length

391

Interactions

View interactions

	KEGG		Reactome
	cAMP signaling pathway Neuroactive ligand-receptor interaction Hormone signaling Growth hormone synthesis, secretion and action		Peptide ligand-binding receptors G alpha (i) signalling events

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Lewy Body Disease	Lewy body disease	N/A	N/A	GWAS

Show/Hide Text Mining Associations (44)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
ACTH Secreting Pituitary Adenoma	Associate	19318729
Adenocarcinoma	Associate	20966542
Adenoma	Associate	25536318
Adrenocortical Carcinoma	Associate	34220331
Atherosclerosis	Associate	10843877
Breast Neoplasms	Associate	35793235
Carcinoid Tumor	Associate	11772967, 8132773
Carcinoma Hepatocellular	Associate	15247189
Carcinoma Neuroendocrine	Associate	27927191
Cholangiocarcinoma	Associate	29282035
Colorectal Neoplasms	Associate	16610049, 27927191
Death	Associate	34220331
Endocrine Gland Neoplasms	Associate	16508627
Epilepsy	Associate	23418513
Epilepsy Familial Mesial Temporal Lobe	Associate	22022585
Glioblastoma	Associate	32626960
Graves Ophthalmopathy	Associate	17848636
Growth Hormone Deficiency With Pituitary Anomalies	Associate	26391562
Growth Hormone Secreting Pituitary Adenoma	Associate	26607296
Hematologic Diseases	Associate	33297556
Hyperpituitarism	Associate	17420609
Insulinoma	Associate	20686293, 8132773
Keratoconus	Associate	19956410
Lymphatic Metastasis	Stimulate	16610049
Meningioma	Associate	33899156
Neoplasm Metastasis	Associate	16508627
Neoplasms	Associate	11772967, 25734919, 26259237, 29282035, 29596435, 31381461, 32429652, 37392167
Neoplasms	Inhibit	34601710
Neuroendocrine Tumors	Associate	20529830, 20682006, 27622342
Neuroma Acoustic	Associate	14747443
Oropharyngeal Neoplasms	Associate	25734919
Pancreatic Neoplasms	Associate	29596435
Pigmented Nodular Adrenocortical Disease Primary 1	Associate	24512486
Pituitary ACTH Hypersecretion	Associate	19318729
Pituitary Neoplasms	Stimulate	19318729
Pituitary Neoplasms	Associate	26607296
Prostatic Intraepithelial Neoplasia	Associate	20966542
Prostatic Neoplasms	Associate	20935156
Prostatic Neoplasms Castration Resistant	Associate	39352383
Squamous Cell Carcinoma of Head and Neck	Associate	25734919
Thyroid Neoplasms	Associate	10768564, 20686293
Thyroiditis	Associate	23672766
Uveal melanoma	Associate	29949880
von Hippel Lindau Disease	Associate	28094316

SSTR1 (somatostatin receptor 1)