SST (somatostatin)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6750
Gene name Gene Name - the full gene name approved by the HGNC.
Somatostatin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SST
Synonyms (NCBI Gene) Gene synonyms aliases
SMST, SST1
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q27.3
Summary Summary of gene provided in NCBI Entrez Gene.
The hormone somatostatin has active 14 aa and 28 aa forms that are produced by alternate cleavage of the single preproprotein encoded by this gene. Somatostatin is expressed throughout the body and inhibits the release of numerous secondary hormones by bi
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(4)
miRTarBase ID miRNA Experiments Reference
MIRT1392811 hsa-miR-23a CLIP-seq
MIRT1392812 hsa-miR-23b CLIP-seq
MIRT1392813 hsa-miR-23c CLIP-seq
MIRT1392814 hsa-miR-5096 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(22)
GO ID Ontology Definition Evidence Reference
GO:0005179 Function Hormone activity TAS 9886848
GO:0005515 Function Protein binding IPI 32814053
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IBA 21873635
GO:0005615 Component Extracellular space TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
182450 11329 ENSG00000157005
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P61278
Protein name Somatostatin (Growth hormone release-inhibiting factor) [Cleaved into: Somatostatin-28; Somatostatin-14 (SST-14); Neuronostatin (NST)]
Protein function [Somatostatin-14]: Inhibits the secretion of pituitary hormones, including that of growth hormone/somatotropin (GH1), PRL, ACTH, luteinizing hormone (LH) and TSH. Also impairs ghrelin- and GnRH-stimulated secretion of GH1 and LH; the inhibition
PDB 2MI1 , 7T10 , 7WIC , 7WJ5 , 7XAT , 7XMR , 7XMS , 7Y27
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03002 Somatostatin 99 → 116 Somatostatin/Cortistatin family Family
Sequence 
MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP
NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
Sequence length 116
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  cAMP signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling
Growth hormone synthesis, secretion and action
Gastric acid secretion 		  Peptide ligand-binding receptors
G alpha (i) signalling events
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (4)
Causal
Disease term Disease name dbSNP ID References
Esophagus neoplasm Esophageal Neoplasms, Malignant neoplasm of esophagus rs28934578, rs121918714, rs1567556006, rs1575166666 17999418
Pancreatic cancer Malignant neoplasm of pancreas rs118203998, rs180177143, rs587776417, rs587776527, rs864622498, rs876659571, rs587778587, rs886039619, rs745533713, rs1555460431 2868874
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)		 22937123, 19804960, 24674775, 24636039, 21745723
Seizure Complex partial seizures, Generalized seizures, Visual seizure, Tonic - clonic seizures, Single Seizure rs587784365, rs28939683, rs74315390, rs28939684, rs74315391, rs267607198, rs74315392, rs118192244, rs118192250, rs121917749, rs121917750, rs121917751, rs121917752, rs267606670, rs267607061
View all (179 more)		 20134357, 7913897, 16771832
Show/Hide Unknown Diseases (6)
Unknown
Disease term Disease name Evidence References Source
Barrett esophagus Barrett Esophagus 17999418 ClinVar
Endometriosis Endometriosis 21063030 ClinVar
Mental depression Unipolar Depression, Major Depressive Disorder 21912391, 21226980 ClinVar
Pancreatitis Pancreatitis 7911442 ClinVar, GWAS
Show/Hide Text Mining Associations (100)
Associations from Text Mining
Disease Name Relationship Type References
Acromegaly Inhibit 23672766
Acromegaly Associate 38123488
ACTH Secreting Pituitary Adenoma Associate 19318729
Adenocarcinoma Associate 17999418
Alzheimer Disease Associate 32232904, 32614981, 33649380, 34556089, 34668150, 36635346, 36776063
Alzheimer Disease Inhibit 34445147
Amyotrophic Lateral Sclerosis Associate 40033250
Anus Neoplasms Associate 30060049
Anxiety Associate 27259817
Astrocytoma Associate 8991628