SST (somatostatin)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6750
Gene name Gene Name - the full gene name approved by the HGNC.
Somatostatin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SST
Synonyms (NCBI Gene) Gene synonyms aliases
SMST, SST1
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q27.3
Summary Summary of gene provided in NCBI Entrez Gene.
The hormone somatostatin has active 14 aa and 28 aa forms that are produced by alternate cleavage of the single preproprotein encoded by this gene. Somatostatin is expressed throughout the body and inhibits the release of numerous secondary hormones by bi
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(4)
miRTarBase ID miRNA Experiments Reference
MIRT1392811 hsa-miR-23a CLIP-seq
MIRT1392812 hsa-miR-23b CLIP-seq
MIRT1392813 hsa-miR-23c CLIP-seq
MIRT1392814 hsa-miR-5096 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(31)
GO ID Ontology Definition Evidence Reference
GO:0005179 Function Hormone activity IEA
GO:0005179 Function Hormone activity TAS 9886848
GO:0005515 Function Protein binding IPI 28650319, 31136617, 32814053, 32915532
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
182450 11329 ENSG00000157005
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P61278
Protein name Somatostatin (Growth hormone release-inhibiting factor) [Cleaved into: Somatostatin-28; Somatostatin-14 (SST-14); Neuronostatin (NST)]
Protein function [Somatostatin-14]: Inhibits the secretion of pituitary hormones, including that of growth hormone/somatotropin (GH1), PRL, ACTH, luteinizing hormone (LH) and TSH. Also impairs ghrelin- and GnRH-stimulated secretion of GH1 and LH; the inhibition
PDB 2MI1 , 7T10 , 7WIC , 7WJ5 , 7XAT , 7XMR , 7XMS , 7Y27
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03002 Somatostatin 99 → 116 Somatostatin/Cortistatin family Family
Sequence 
MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP
NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
Sequence length 116
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  cAMP signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling
Growth hormone synthesis, secretion and action
Gastric acid secretion 		  Peptide ligand-binding receptors
G alpha (i) signalling events
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (3)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Postmenopausal breast cancer N/A N/A GWAS
Oligodendroglioma Oligodendroglioma N/A N/A GWAS
Pancreatitis Acute pancreatitis N/A N/A GWAS
Show/Hide Text Mining Associations (100)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acromegaly Inhibit 23672766
Acromegaly Associate 38123488
ACTH Secreting Pituitary Adenoma Associate 19318729
Adenocarcinoma Associate 17999418
Alzheimer Disease Associate 32232904, 32614981, 33649380, 34556089, 34668150, 36635346, 36776063
Alzheimer Disease Inhibit 34445147
Amyotrophic Lateral Sclerosis Associate 40033250
Anus Neoplasms Associate 30060049
Anxiety Associate 27259817
Astrocytoma Associate 8991628