SST (somatostatin)

Gene

• Entrez ID: 6750
• Gene name: Somatostatin
• Gene symbol: SST
• Synonyms (NCBI Gene): SMST, SST1
• Chromosome: 3
• Chromosome location: 3q27.3
• Summary: The hormone somatostatin has active 14 aa and 28 aa forms that are produced by alternate cleavage of the single preproprotein encoded by this gene. Somatostatin is expressed throughout the body and inhibits the release of numerous secondary hormones by bi

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1392811	hsa-miR-23a	CLIP-seq
MIRT1392812	hsa-miR-23b	CLIP-seq
MIRT1392813	hsa-miR-23c	CLIP-seq
MIRT1392814	hsa-miR-5096	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005179	Function	Hormone activity	IEA
GO:0005179	Function	Hormone activity	TAS	9886848
GO:0005515	Function	Protein binding	IPI	28650319, 31136617, 32814053, 32915532
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS
GO:0005829	Component	Cytosol	IEA
GO:0006972	Process	Hyperosmotic response	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	TAS
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	8405411
GO:0007267	Process	Cell-cell signaling	TAS
GO:0007268	Process	Chemical synaptic transmission	TAS
GO:0007584	Process	Response to nutrient	TAS
GO:0007586	Process	Digestion	TAS
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	9886848
GO:0008628	Process	Hormone-mediated apoptotic signaling pathway	TAS	8961277
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010447	Process	Response to acidic pH	IEA
GO:0030334	Process	Regulation of cell migration	IBA
GO:0030334	Process	Regulation of cell migration	IEA
GO:0038170	Process	Somatostatin signaling pathway	IEA
GO:0042802	Function	Identical protein binding	IPI	15247250, 28650319, 32915532
GO:0043025	Component	Neuronal cell body	IEA
GO:0043200	Process	Response to amino acid	IEA
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048545	Process	Response to steroid hormone	IEA
GO:0098982	Component	GABA-ergic synapse	IEA
GO:0098992	Component	Neuronal dense core vesicle	IEA
GO:0099072	Process	Regulation of postsynaptic membrane neurotransmitter receptor levels	IEA

Other IDs

• MIM: 182450
• HGNC: 11329
• e!Ensembl: ENSG00000157005

Protein

• UniProt ID: P61278
• Protein name: Somatostatin (Growth hormone release-inhibiting factor) [Cleaved into: Somatostatin-28; Somatostatin-14 (SST-14); Neuronostatin (NST)]
• Protein function: [Somatostatin-14]: Inhibits the secretion of pituitary hormones, including that of growth hormone/somatotropin (GH1), PRL, ACTH, luteinizing hormone (LH) and TSH. Also impairs ghrelin- and GnRH-stimulated secretion of GH1 and LH; the inhibition
• PDB: 2MI1, 7T10, 7WIC, 7WJ5, 7XAT, 7XMR, 7XMS, 7Y27
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03002	Somatostatin	99 → 116	Somatostatin/Cortistatin family	Family

• Sequence:

  MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP
  NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC

• Sequence length: 116

Pathways

KEGG:

cAMP signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling
Growth hormone synthesis, secretion and action
Gastric acid secretion

Reactome:

Peptide ligand-binding receptors
G alpha (i) signalling events