SRMS (src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites)

Gene

• Entrez ID: 6725
• Gene name: Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites
• Gene symbol: SRMS
• Synonyms (NCBI Gene): C20orf148, PTK70, SRM, dJ697K14.1
• Chromosome: 20
• Chromosome location: 20q13.33

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	EXP	25897081
GO:0004713	Function	Protein tyrosine kinase activity	IDA	23822091, 29496907, 35927303
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	23822091, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IDA	23822091, 29496907
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IBA
GO:0009968	Process	Negative regulation of signal transduction	TAS
GO:0016301	Function	Kinase activity	IEA
GO:0016579	Process	Protein deubiquitination	IDA	35927303
GO:0016740	Function	Transferase activity	IEA
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IDA	29496907
GO:0030154	Process	Cell differentiation	IBA
GO:0031669	Process	Cellular response to nutrient levels	IDA	12747827, 29750193
GO:0038083	Process	Peptidyl-tyrosine autophosphorylation	IDA	23822091
GO:0038202	Process	TORC1 signaling	IDA	12747827, 29750193
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	35927303
GO:1904262	Process	Negative regulation of TORC1 signaling	IDA	35927303
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	35927303
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	35927303

Other IDs

• MIM: 617797
• HGNC: 11298
• e!Ensembl: ENSG00000125508

Protein

• UniProt ID: Q9H3Y6
• Protein name: Tyrosine-protein kinase Srms (EC 2.7.10.2)
• Protein function: Non-receptor tyrosine-protein kinase which phosphorylates DOK1 on tyrosine residues (PubMed:23822091). Also phosphorylates KHDRBS1/SAM68 and VIM on tyrosine residues (PubMed:29496907). Phosphorylation of KHDRBS1 is EGF-dependent (PubMed:29496907
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00017	SH2	120 → 197	SH2 domain	Domain
  PF07714	PK_Tyr_Ser-Thr	230 → 480	Protein tyrosine and serine/threonine kinase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in most breast cancers (at protein level).
• Sequence:

  MEPFLRRRLAFLSFFWDKIWPAGGEPDHGTPGSLDPNTDPVPTLPAEPCSPFPQLFLALY
  DFTARCGGELSVRRGDRLCALEEGGGYIFARRLSGQPSAGLVPITHVAKASPETLSDQPW
  YFSGVSRTQAQQLLLSPPNEPGAFLIRPSESSLGGYSLSVRAQAKVCHYRVSMAADGSLY
  LQKGRLFPGLEELLTYYKANWKLIQNPLLQPCMPQKAPRQDVWERPHSEFALGRKLGEGY
  FGEVWEGLWLGSLPVAIKVIKSANMKLTDLAKEIQTLKGLRHERLIRLHAVCSGGEPVYI
  VTELMRKGNLQAFLGTPEGRALRLPPLLGFACQVAEGMSYLEEQRVVHRDLAARNVLVDD
  GLACKVADFGLARLLKDDIYSPSSSSKIPVKWTAPEAANYRVFSQKSDVWSFGVLLHEVF
  TYGQCPYEGMTNHETLQQIMRGYRLPRPAACPAEVYVLMLECWRSSPEERPSFATLREKL
  HAIHRCHP

• Sequence length: 488

Pathways

Reactome:

PTK6 Down-Regulation

<