Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6722
Gene name Gene Name - the full gene name approved by the HGNC.
Serum response factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SRF
Synonyms (NCBI Gene) Gene synonyms aliases
MCM1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a ubiquitous nuclear protein that stimulates both cell proliferation and differentiation. It is a member of the MADS (MCM1, Agamous, Deficiens, and SRF) box superfamily of transcription factors. This protein binds to the serum response e
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000365 hsa-miR-122-5p Luciferase reporter assay, qRT-PCR, Western blot 19726678
MIRT000365 hsa-miR-122-5p Luciferase reporter assay, qRT-PCR, Western blot 19726678
MIRT006153 hsa-miR-483-5p Luciferase reporter assay, qRT-PCR, Western blot 21893058
MIRT006153 hsa-miR-483-5p Luciferase reporter assay, qRT-PCR, Western blot 21893058
MIRT006153 hsa-miR-483-5p Luciferase reporter assay, qRT-PCR, Western blot 21893058
Transcription factors
Transcription factor Regulation Reference
ATF6 Unknown 9271374
ELK1 Unknown 15531578
MKL1 Unknown 14565952
NR3C1 Repression 17016446
TEAD1 Unknown 24344135
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 1509260
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding ISS
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IDA 20808827
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600589 11291 ENSG00000112658
Protein
UniProt ID P11831
Protein name Serum response factor (SRF)
Protein function SRF is a transcription factor that binds to the serum response element (SRE), a short sequence of dyad symmetry located 300 bp to the 5' of the site of transcription initiation of some genes (such as FOS). Together with MRTFA transcription coact
PDB 1HBX , 1K6O , 1SRS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00319 SRF-TF 150 197 SRF-type transcription factor (DNA-binding and dimerisation domain) Domain
Sequence
MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREA
AAAAATTPAPTAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMEIGMVVGGPEASAAA
TGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTG
TQVLLLVASETGHVYTF
ATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATG
FEETDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPIT
NYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPGGAVAQQVPVQAI
QVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPT
SGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAV
IGQQAGSSSNLTELQVVNLDTAHSTKSE
Sequence length 508
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  MAPK signaling pathway
cGMP-PKG signaling pathway
Human T-cell leukemia virus 1 infection
Viral carcinogenesis
  RHO GTPases Activate Formins
NGF-stimulated transcription
Estrogen-dependent nuclear events downstream of ESR-membrane signaling