Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6722
Gene name	Serum response factor
Gene symbol	SRF
Synonyms (NCBI Gene)	MCM1
Chromosome	6
Chromosome location	6p21.1
Summary	This gene encodes a ubiquitous nuclear protein that stimulates both cell proliferation and differentiation. It is a member of the MADS (MCM1, Agamous, Deficiens, and SRF) box superfamily of transcription factors. This protein binds to the serum response e

477

Show/Hide all (477)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000365	hsa-miR-122-5p	Luciferase reporter assayqRT-PCRWestern blot	19726678
MIRT000365	hsa-miR-122-5p	Luciferase reporter assayqRT-PCRWestern blot	19726678
MIRT006153	hsa-miR-483-5p	Luciferase reporter assayqRT-PCRWestern blot	21893058
MIRT006153	hsa-miR-483-5p	Luciferase reporter assayqRT-PCRWestern blot	21893058
MIRT006153	hsa-miR-483-5p	Luciferase reporter assayqRT-PCRWestern blot	21893058
MIRT006153	hsa-miR-483-5p	Luciferase reporter assayqRT-PCRWestern blot	21893058
MIRT006833	hsa-miR-9-5p	ImmunoblotLuciferase reporter assayqRT-PCR	22907787
MIRT006834	hsa-miR-200a-3p	ImmunoblotLuciferase reporter assayqRT-PCR	22907787
MIRT006834	hsa-miR-200a-3p	ImmunoblotLuciferase reporter assayqRT-PCR	22907787
MIRT023547	hsa-miR-1-3p	Western blot	20458751
MIRT028897	hsa-miR-26b-5p	Microarray	19088304
MIRT049829	hsa-miR-92a-3p	CLASH	23622248
MIRT044832	hsa-miR-320a	CLASH	23622248
MIRT043424	hsa-miR-331-3p	CLASH	23622248
MIRT042926	hsa-miR-324-3p	CLASH	23622248
MIRT041943	hsa-miR-484	CLASH	23622248
MIRT040918	hsa-miR-18a-3p	CLASH	23622248
MIRT719474	hsa-miR-4640-3p	HITS-CLIP	19536157
MIRT719473	hsa-miR-4722-3p	HITS-CLIP	19536157
MIRT719472	hsa-miR-6727-3p	HITS-CLIP	19536157
MIRT719471	hsa-miR-6747-3p	HITS-CLIP	19536157
MIRT719470	hsa-miR-6511a-3p	HITS-CLIP	19536157
MIRT719469	hsa-miR-6511b-3p	HITS-CLIP	19536157
MIRT719468	hsa-miR-6784-3p	HITS-CLIP	19536157
MIRT719467	hsa-miR-6862-3p	HITS-CLIP	19536157
MIRT719466	hsa-miR-2682-3p	HITS-CLIP	19536157
MIRT719465	hsa-miR-6781-3p	HITS-CLIP	19536157
MIRT719464	hsa-miR-6802-3p	HITS-CLIP	19536157
MIRT719463	hsa-miR-1229-3p	HITS-CLIP	19536157
MIRT719462	hsa-miR-3074-5p	HITS-CLIP	19536157
MIRT719461	hsa-miR-6804-3p	HITS-CLIP	19536157
MIRT733573	hsa-miR-330-5p	Luciferase reporter assayRNA-seq	31967986
MIRT733573	hsa-miR-330-5p	Luciferase reporter assayRNA-seq	31967986
MIRT719474	hsa-miR-4640-3p	HITS-CLIP	19536157
MIRT719473	hsa-miR-4722-3p	HITS-CLIP	19536157
MIRT719472	hsa-miR-6727-3p	HITS-CLIP	19536157
MIRT719471	hsa-miR-6747-3p	HITS-CLIP	19536157
MIRT719470	hsa-miR-6511a-3p	HITS-CLIP	19536157
MIRT719469	hsa-miR-6511b-3p	HITS-CLIP	19536157
MIRT719468	hsa-miR-6784-3p	HITS-CLIP	19536157
MIRT719467	hsa-miR-6862-3p	HITS-CLIP	19536157
MIRT719466	hsa-miR-2682-3p	HITS-CLIP	19536157
MIRT719465	hsa-miR-6781-3p	HITS-CLIP	19536157
MIRT719464	hsa-miR-6802-3p	HITS-CLIP	19536157
MIRT719463	hsa-miR-1229-3p	HITS-CLIP	19536157
MIRT719462	hsa-miR-3074-5p	HITS-CLIP	19536157
MIRT719461	hsa-miR-6804-3p	HITS-CLIP	19536157
MIRT755749	hsa-miR-423-5p	Luciferase reporter assayWestern blottingqRT-PCRELISA	38790235
MIRT1388307	hsa-miR-101	CLIP-seq
MIRT1388308	hsa-miR-1178	CLIP-seq
MIRT1388309	hsa-miR-1254	CLIP-seq
MIRT1388310	hsa-miR-1275	CLIP-seq
MIRT1388311	hsa-miR-1285	CLIP-seq
MIRT1388312	hsa-miR-1302	CLIP-seq
MIRT1388313	hsa-miR-142-5p	CLIP-seq
MIRT1388314	hsa-miR-144	CLIP-seq
MIRT1388315	hsa-miR-148a	CLIP-seq
MIRT1388316	hsa-miR-148b	CLIP-seq
MIRT1388317	hsa-miR-150	CLIP-seq
MIRT1388318	hsa-miR-152	CLIP-seq
MIRT1388319	hsa-miR-1825	CLIP-seq
MIRT1388320	hsa-miR-193a-5p	CLIP-seq
MIRT1388321	hsa-miR-1976	CLIP-seq
MIRT1388322	hsa-miR-200b	CLIP-seq
MIRT1388323	hsa-miR-200c	CLIP-seq
MIRT1388324	hsa-miR-2113	CLIP-seq
MIRT1388325	hsa-miR-22	CLIP-seq
MIRT1388326	hsa-miR-2277-3p	CLIP-seq
MIRT1388327	hsa-miR-296-5p	CLIP-seq
MIRT1388328	hsa-miR-31	CLIP-seq
MIRT1388329	hsa-miR-3116	CLIP-seq
MIRT1388330	hsa-miR-3120-3p	CLIP-seq
MIRT1388331	hsa-miR-3120-5p	CLIP-seq
MIRT1388332	hsa-miR-3125	CLIP-seq
MIRT1388333	hsa-miR-3150a-3p	CLIP-seq
MIRT1388334	hsa-miR-3152-5p	CLIP-seq
MIRT1388335	hsa-miR-3160-5p	CLIP-seq
MIRT1388336	hsa-miR-3174	CLIP-seq
MIRT1388337	hsa-miR-3187-5p	CLIP-seq
MIRT1388338	hsa-miR-329	CLIP-seq
MIRT1388339	hsa-miR-342-3p	CLIP-seq
MIRT1388340	hsa-miR-3616-3p	CLIP-seq
MIRT1388341	hsa-miR-362-3p	CLIP-seq
MIRT1388342	hsa-miR-3671	CLIP-seq
MIRT1388343	hsa-miR-3680	CLIP-seq
MIRT1388344	hsa-miR-377	CLIP-seq
MIRT1388345	hsa-miR-3908	CLIP-seq
MIRT1388346	hsa-miR-3909	CLIP-seq
MIRT1388347	hsa-miR-3916	CLIP-seq
MIRT1388348	hsa-miR-3922-5p	CLIP-seq
MIRT1388349	hsa-miR-3928	CLIP-seq
MIRT1388350	hsa-miR-3937	CLIP-seq
MIRT1388351	hsa-miR-4265	CLIP-seq
MIRT1388352	hsa-miR-4279	CLIP-seq
MIRT1388353	hsa-miR-429	CLIP-seq
MIRT1388354	hsa-miR-4292	CLIP-seq
MIRT1388355	hsa-miR-4296	CLIP-seq
MIRT1388356	hsa-miR-4298	CLIP-seq
MIRT1388357	hsa-miR-4308	CLIP-seq
MIRT1388358	hsa-miR-4322	CLIP-seq
MIRT1388359	hsa-miR-4428	CLIP-seq
MIRT1388360	hsa-miR-4433	CLIP-seq
MIRT1388361	hsa-miR-4447	CLIP-seq
MIRT1388362	hsa-miR-4472	CLIP-seq
MIRT1388363	hsa-miR-4481	CLIP-seq
MIRT1388364	hsa-miR-4492	CLIP-seq
MIRT1388365	hsa-miR-4498	CLIP-seq
MIRT1388366	hsa-miR-4505	CLIP-seq
MIRT1388367	hsa-miR-4525	CLIP-seq
MIRT1388368	hsa-miR-4528	CLIP-seq
MIRT1388369	hsa-miR-4533	CLIP-seq
MIRT1388370	hsa-miR-4648	CLIP-seq
MIRT1388371	hsa-miR-4654	CLIP-seq
MIRT1388372	hsa-miR-4659a-3p	CLIP-seq
MIRT1388373	hsa-miR-4659b-3p	CLIP-seq
MIRT1388374	hsa-miR-4665-5p	CLIP-seq
MIRT1388375	hsa-miR-4696	CLIP-seq
MIRT1388376	hsa-miR-4698	CLIP-seq
MIRT1388377	hsa-miR-4707-5p	CLIP-seq
MIRT1388378	hsa-miR-4717-5p	CLIP-seq
MIRT1388379	hsa-miR-4721	CLIP-seq
MIRT1388380	hsa-miR-4745-5p	CLIP-seq
MIRT1388381	hsa-miR-4747-5p	CLIP-seq
MIRT1388382	hsa-miR-4749-3p	CLIP-seq
MIRT1388383	hsa-miR-4753-5p	CLIP-seq
MIRT1388384	hsa-miR-4760-3p	CLIP-seq
MIRT1388385	hsa-miR-4765	CLIP-seq
MIRT1388386	hsa-miR-4769-5p	CLIP-seq
MIRT1388387	hsa-miR-4774-3p	CLIP-seq
MIRT1388388	hsa-miR-4775	CLIP-seq
MIRT1388389	hsa-miR-4789-3p	CLIP-seq
MIRT1388390	hsa-miR-491-5p	CLIP-seq
MIRT1388391	hsa-miR-5096	CLIP-seq
MIRT1388392	hsa-miR-510	CLIP-seq
MIRT1388393	hsa-miR-511	CLIP-seq
MIRT1388394	hsa-miR-548an	CLIP-seq
MIRT1388395	hsa-miR-548c-3p	CLIP-seq
MIRT1388396	hsa-miR-574-3p	CLIP-seq
MIRT1388397	hsa-miR-582-5p	CLIP-seq
MIRT1388398	hsa-miR-612	CLIP-seq
MIRT1388399	hsa-miR-625	CLIP-seq
MIRT1388400	hsa-miR-661	CLIP-seq
MIRT1388401	hsa-miR-708	CLIP-seq
MIRT1388402	hsa-miR-762	CLIP-seq
MIRT1388403	hsa-miR-767-3p	CLIP-seq
MIRT1388404	hsa-miR-877	CLIP-seq
MIRT1388405	hsa-miR-935	CLIP-seq
MIRT1388406	hsa-miR-939	CLIP-seq
MIRT1388348	hsa-miR-3922-5p	CLIP-seq
MIRT1388378	hsa-miR-4717-5p	CLIP-seq
MIRT1388383	hsa-miR-4753-5p	CLIP-seq
MIRT1388308	hsa-miR-1178	CLIP-seq
MIRT2116298	hsa-miR-1197	CLIP-seq
MIRT2116299	hsa-miR-1207-5p	CLIP-seq
MIRT2116300	hsa-miR-1224-3p	CLIP-seq
MIRT2116301	hsa-miR-1225-5p	CLIP-seq
MIRT2116302	hsa-miR-1229	CLIP-seq
MIRT2116303	hsa-miR-125a-5p	CLIP-seq
MIRT2116304	hsa-miR-125b	CLIP-seq
MIRT2116305	hsa-miR-1260	CLIP-seq
MIRT2116306	hsa-miR-1260b	CLIP-seq
MIRT2116307	hsa-miR-1280	CLIP-seq
MIRT2116308	hsa-miR-1281	CLIP-seq
MIRT2116309	hsa-miR-1343	CLIP-seq
MIRT2116310	hsa-miR-1470	CLIP-seq
MIRT1388317	hsa-miR-150	CLIP-seq
MIRT2116311	hsa-miR-1539	CLIP-seq
MIRT2116312	hsa-miR-186	CLIP-seq
MIRT2116313	hsa-miR-188-5p	CLIP-seq
MIRT2116314	hsa-miR-1915	CLIP-seq
MIRT1388320	hsa-miR-193a-5p	CLIP-seq
MIRT1388321	hsa-miR-1976	CLIP-seq
MIRT1388322	hsa-miR-200b	CLIP-seq
MIRT1388323	hsa-miR-200c	CLIP-seq
MIRT1388324	hsa-miR-2113	CLIP-seq
MIRT2116315	hsa-miR-2115	CLIP-seq
MIRT2116316	hsa-miR-223	CLIP-seq
MIRT1388327	hsa-miR-296-5p	CLIP-seq
MIRT1388328	hsa-miR-31	CLIP-seq
MIRT1388331	hsa-miR-3120-5p	CLIP-seq
MIRT1388332	hsa-miR-3125	CLIP-seq
MIRT2116317	hsa-miR-3133	CLIP-seq
MIRT1388333	hsa-miR-3150a-3p	CLIP-seq
MIRT2116318	hsa-miR-3151	CLIP-seq
MIRT1388334	hsa-miR-3152-5p	CLIP-seq
MIRT2116319	hsa-miR-3163	CLIP-seq
MIRT2116320	hsa-miR-3169	CLIP-seq
MIRT2116321	hsa-miR-3184	CLIP-seq
MIRT2116322	hsa-miR-3193	CLIP-seq
MIRT2116323	hsa-miR-324-5p	CLIP-seq
MIRT1388339	hsa-miR-342-3p	CLIP-seq
MIRT1388340	hsa-miR-3616-3p	CLIP-seq
MIRT2116324	hsa-miR-3646	CLIP-seq
MIRT2116325	hsa-miR-3661	CLIP-seq
MIRT1388342	hsa-miR-3671	CLIP-seq
MIRT1388343	hsa-miR-3680	CLIP-seq
MIRT2116326	hsa-miR-3688-5p	CLIP-seq
MIRT2116327	hsa-miR-3689d	CLIP-seq
MIRT2116328	hsa-miR-3714	CLIP-seq
MIRT1388344	hsa-miR-377	CLIP-seq
MIRT1388346	hsa-miR-3909	CLIP-seq
MIRT1388347	hsa-miR-3916	CLIP-seq
MIRT1388348	hsa-miR-3922-5p	CLIP-seq
MIRT1388350	hsa-miR-3937	CLIP-seq
MIRT755749	hsa-miR-423-5p	CLIP-seq
MIRT2116329	hsa-miR-4257	CLIP-seq
MIRT1388351	hsa-miR-4265	CLIP-seq
MIRT1388352	hsa-miR-4279	CLIP-seq
MIRT1388353	hsa-miR-429	CLIP-seq
MIRT2116330	hsa-miR-4290	CLIP-seq
MIRT1388355	hsa-miR-4296	CLIP-seq
MIRT1388357	hsa-miR-4308	CLIP-seq
MIRT2116331	hsa-miR-4310	CLIP-seq
MIRT2116332	hsa-miR-4313	CLIP-seq
MIRT2116333	hsa-miR-4319	CLIP-seq
MIRT1388358	hsa-miR-4322	CLIP-seq
MIRT2116334	hsa-miR-4323	CLIP-seq
MIRT2116335	hsa-miR-4423-5p	CLIP-seq
MIRT1388359	hsa-miR-4428	CLIP-seq
MIRT1388360	hsa-miR-4433	CLIP-seq
MIRT2116336	hsa-miR-4436b-3p	CLIP-seq
MIRT2116337	hsa-miR-4446-3p	CLIP-seq
MIRT2116338	hsa-miR-4462	CLIP-seq
MIRT2116339	hsa-miR-4469	CLIP-seq
MIRT2116340	hsa-miR-4470	CLIP-seq
MIRT2116341	hsa-miR-4493	CLIP-seq
MIRT1388368	hsa-miR-4528	CLIP-seq
MIRT1388369	hsa-miR-4533	CLIP-seq
MIRT2116342	hsa-miR-4641	CLIP-seq
MIRT1388370	hsa-miR-4648	CLIP-seq
MIRT1388371	hsa-miR-4654	CLIP-seq
MIRT2116343	hsa-miR-4656	CLIP-seq
MIRT2116344	hsa-miR-4667-3p	CLIP-seq
MIRT2116345	hsa-miR-4668-3p	CLIP-seq
MIRT2116346	hsa-miR-4685-5p	CLIP-seq
MIRT2116347	hsa-miR-4688	CLIP-seq
MIRT1388376	hsa-miR-4698	CLIP-seq
MIRT2116348	hsa-miR-4708-3p	CLIP-seq
MIRT1388378	hsa-miR-4717-5p	CLIP-seq
MIRT2116349	hsa-miR-4719	CLIP-seq
MIRT1388379	hsa-miR-4721	CLIP-seq
MIRT2116350	hsa-miR-4726-3p	CLIP-seq
MIRT2116351	hsa-miR-4728-5p	CLIP-seq
MIRT2116352	hsa-miR-4746-5p	CLIP-seq
MIRT1388381	hsa-miR-4747-5p	CLIP-seq
MIRT1388383	hsa-miR-4753-5p	CLIP-seq
MIRT2116353	hsa-miR-4758-3p	CLIP-seq
MIRT1388384	hsa-miR-4760-3p	CLIP-seq
MIRT2116354	hsa-miR-4763-3p	CLIP-seq
MIRT1388386	hsa-miR-4769-5p	CLIP-seq
MIRT1388387	hsa-miR-4774-3p	CLIP-seq
MIRT2116355	hsa-miR-4780	CLIP-seq
MIRT2116356	hsa-miR-486-3p	CLIP-seq
MIRT1388390	hsa-miR-491-5p	CLIP-seq
MIRT1388391	hsa-miR-5096	CLIP-seq
MIRT1388392	hsa-miR-510	CLIP-seq
MIRT1388393	hsa-miR-511	CLIP-seq
MIRT2116357	hsa-miR-516a-3p	CLIP-seq
MIRT2116358	hsa-miR-532-3p	CLIP-seq
MIRT2116359	hsa-miR-544b	CLIP-seq
MIRT2116360	hsa-miR-555	CLIP-seq
MIRT2116361	hsa-miR-564	CLIP-seq
MIRT1388396	hsa-miR-574-3p	CLIP-seq
MIRT2116362	hsa-miR-631	CLIP-seq
MIRT2116363	hsa-miR-635	CLIP-seq
MIRT2116364	hsa-miR-642a	CLIP-seq
MIRT2116365	hsa-miR-642b	CLIP-seq
MIRT2116366	hsa-miR-644	CLIP-seq
MIRT2116367	hsa-miR-647	CLIP-seq
MIRT1388401	hsa-miR-708	CLIP-seq
MIRT1388403	hsa-miR-767-3p	CLIP-seq
MIRT1388406	hsa-miR-939	CLIP-seq
MIRT1388308	hsa-miR-1178	CLIP-seq
MIRT2116300	hsa-miR-1224-3p	CLIP-seq
MIRT2116305	hsa-miR-1260	CLIP-seq
MIRT2116306	hsa-miR-1260b	CLIP-seq
MIRT2116307	hsa-miR-1280	CLIP-seq
MIRT1388313	hsa-miR-142-5p	CLIP-seq
MIRT2338869	hsa-miR-146a	CLIP-seq
MIRT2338870	hsa-miR-146b-5p	CLIP-seq
MIRT2338871	hsa-miR-149	CLIP-seq
MIRT1388317	hsa-miR-150	CLIP-seq
MIRT2116314	hsa-miR-1915	CLIP-seq
MIRT2338872	hsa-miR-3064-5p	CLIP-seq
MIRT2338873	hsa-miR-3119	CLIP-seq
MIRT2338874	hsa-miR-3127-3p	CLIP-seq
MIRT1388334	hsa-miR-3152-5p	CLIP-seq
MIRT2338875	hsa-miR-3173-3p	CLIP-seq
MIRT2338876	hsa-miR-3189-5p	CLIP-seq
MIRT2338877	hsa-miR-3192	CLIP-seq
MIRT2338878	hsa-miR-3202	CLIP-seq
MIRT1388338	hsa-miR-329	CLIP-seq
MIRT1388339	hsa-miR-342-3p	CLIP-seq
MIRT2338879	hsa-miR-34b	CLIP-seq
MIRT1388340	hsa-miR-3616-3p	CLIP-seq
MIRT1388341	hsa-miR-362-3p	CLIP-seq
MIRT2116324	hsa-miR-3646	CLIP-seq
MIRT1388343	hsa-miR-3680	CLIP-seq
MIRT2116326	hsa-miR-3688-5p	CLIP-seq
MIRT2116328	hsa-miR-3714	CLIP-seq
MIRT2338880	hsa-miR-371-5p	CLIP-seq
MIRT2338881	hsa-miR-371b-5p	CLIP-seq
MIRT1388344	hsa-miR-377	CLIP-seq
MIRT1388345	hsa-miR-3908	CLIP-seq
MIRT1388346	hsa-miR-3909	CLIP-seq
MIRT1388348	hsa-miR-3922-5p	CLIP-seq
MIRT1388349	hsa-miR-3928	CLIP-seq
MIRT2338882	hsa-miR-4271	CLIP-seq
MIRT2338883	hsa-miR-4278	CLIP-seq
MIRT2116330	hsa-miR-4290	CLIP-seq
MIRT1388354	hsa-miR-4292	CLIP-seq
MIRT1388357	hsa-miR-4308	CLIP-seq
MIRT2338884	hsa-miR-4326	CLIP-seq
MIRT1388360	hsa-miR-4433	CLIP-seq
MIRT2116340	hsa-miR-4470	CLIP-seq
MIRT2338885	hsa-miR-4476	CLIP-seq
MIRT1388368	hsa-miR-4528	CLIP-seq
MIRT1388369	hsa-miR-4533	CLIP-seq
MIRT2116342	hsa-miR-4641	CLIP-seq
MIRT2338886	hsa-miR-4659a-5p	CLIP-seq
MIRT2338887	hsa-miR-4659b-5p	CLIP-seq
MIRT2338888	hsa-miR-4676-5p	CLIP-seq
MIRT2338889	hsa-miR-4691-5p	CLIP-seq
MIRT1388378	hsa-miR-4717-5p	CLIP-seq
MIRT2116349	hsa-miR-4719	CLIP-seq
MIRT1388379	hsa-miR-4721	CLIP-seq
MIRT2338890	hsa-miR-4725-3p	CLIP-seq
MIRT2116350	hsa-miR-4726-3p	CLIP-seq
MIRT1388383	hsa-miR-4753-5p	CLIP-seq
MIRT2116353	hsa-miR-4758-3p	CLIP-seq
MIRT1388387	hsa-miR-4774-3p	CLIP-seq
MIRT2338891	hsa-miR-4776-3p	CLIP-seq
MIRT2116355	hsa-miR-4780	CLIP-seq
MIRT2338892	hsa-miR-4786-3p	CLIP-seq
MIRT2338893	hsa-miR-4794	CLIP-seq
MIRT2116356	hsa-miR-486-3p	CLIP-seq
MIRT2338894	hsa-miR-488	CLIP-seq
MIRT1388392	hsa-miR-510	CLIP-seq
MIRT1388393	hsa-miR-511	CLIP-seq
MIRT2116358	hsa-miR-532-3p	CLIP-seq
MIRT2116359	hsa-miR-544b	CLIP-seq
MIRT1388396	hsa-miR-574-3p	CLIP-seq
MIRT2338895	hsa-miR-575	CLIP-seq
MIRT2338896	hsa-miR-604	CLIP-seq
MIRT2116365	hsa-miR-642b	CLIP-seq
MIRT2116366	hsa-miR-644	CLIP-seq
MIRT2116367	hsa-miR-647	CLIP-seq
MIRT1388401	hsa-miR-708	CLIP-seq
MIRT1388403	hsa-miR-767-3p	CLIP-seq
MIRT1388404	hsa-miR-877	CLIP-seq
MIRT1388307	hsa-miR-101	CLIP-seq
MIRT1388308	hsa-miR-1178	CLIP-seq
MIRT1388314	hsa-miR-144	CLIP-seq
MIRT2338869	hsa-miR-146a	CLIP-seq
MIRT2338870	hsa-miR-146b-5p	CLIP-seq
MIRT1388325	hsa-miR-22	CLIP-seq
MIRT1388328	hsa-miR-31	CLIP-seq
MIRT1388334	hsa-miR-3152-5p	CLIP-seq
MIRT2338877	hsa-miR-3192	CLIP-seq
MIRT1388339	hsa-miR-342-3p	CLIP-seq
MIRT1388343	hsa-miR-3680	CLIP-seq
MIRT1388344	hsa-miR-377	CLIP-seq
MIRT1388354	hsa-miR-4292	CLIP-seq
MIRT1388357	hsa-miR-4308	CLIP-seq
MIRT1388368	hsa-miR-4528	CLIP-seq
MIRT2116342	hsa-miR-4641	CLIP-seq
MIRT1388387	hsa-miR-4774-3p	CLIP-seq
MIRT1388392	hsa-miR-510	CLIP-seq
MIRT1388397	hsa-miR-582-5p	CLIP-seq
MIRT2116365	hsa-miR-642b	CLIP-seq
MIRT1388403	hsa-miR-767-3p	CLIP-seq
MIRT1388317	hsa-miR-150	CLIP-seq
MIRT2116315	hsa-miR-2115	CLIP-seq
MIRT1388346	hsa-miR-3909	CLIP-seq
MIRT1388348	hsa-miR-3922-5p	CLIP-seq
MIRT2116329	hsa-miR-4257	CLIP-seq
MIRT1388378	hsa-miR-4717-5p	CLIP-seq
MIRT1388383	hsa-miR-4753-5p	CLIP-seq
MIRT2116357	hsa-miR-516a-3p	CLIP-seq
MIRT1388317	hsa-miR-150	CLIP-seq
MIRT2632349	hsa-miR-181a	CLIP-seq
MIRT2632350	hsa-miR-181b	CLIP-seq
MIRT2632351	hsa-miR-181c	CLIP-seq
MIRT2632352	hsa-miR-181d	CLIP-seq
MIRT1388320	hsa-miR-193a-5p	CLIP-seq
MIRT1388324	hsa-miR-2113	CLIP-seq
MIRT2632353	hsa-miR-23a	CLIP-seq
MIRT2632354	hsa-miR-23b	CLIP-seq
MIRT2632355	hsa-miR-23c	CLIP-seq
MIRT1388331	hsa-miR-3120-5p	CLIP-seq
MIRT1388334	hsa-miR-3152-5p	CLIP-seq
MIRT2338878	hsa-miR-3202	CLIP-seq
MIRT1388338	hsa-miR-329	CLIP-seq
MIRT1388339	hsa-miR-342-3p	CLIP-seq
MIRT2632356	hsa-miR-3591-3p	CLIP-seq
MIRT1388341	hsa-miR-362-3p	CLIP-seq
MIRT1388343	hsa-miR-3680	CLIP-seq
MIRT1388344	hsa-miR-377	CLIP-seq
MIRT1388346	hsa-miR-3909	CLIP-seq
MIRT1388348	hsa-miR-3922-5p	CLIP-seq
MIRT1388350	hsa-miR-3937	CLIP-seq
MIRT2632357	hsa-miR-3941	CLIP-seq
MIRT2632358	hsa-miR-4261	CLIP-seq
MIRT2632359	hsa-miR-4262	CLIP-seq
MIRT1388351	hsa-miR-4265	CLIP-seq
MIRT1388355	hsa-miR-4296	CLIP-seq
MIRT1388358	hsa-miR-4322	CLIP-seq
MIRT2338885	hsa-miR-4476	CLIP-seq
MIRT1388368	hsa-miR-4528	CLIP-seq
MIRT1388369	hsa-miR-4533	CLIP-seq
MIRT1388370	hsa-miR-4648	CLIP-seq
MIRT1388371	hsa-miR-4654	CLIP-seq
MIRT1388378	hsa-miR-4717-5p	CLIP-seq
MIRT1388381	hsa-miR-4747-5p	CLIP-seq
MIRT1388383	hsa-miR-4753-5p	CLIP-seq
MIRT1388386	hsa-miR-4769-5p	CLIP-seq
MIRT1388387	hsa-miR-4774-3p	CLIP-seq
MIRT1388389	hsa-miR-4789-3p	CLIP-seq
MIRT2632360	hsa-miR-498	CLIP-seq
MIRT1388392	hsa-miR-510	CLIP-seq
MIRT1388393	hsa-miR-511	CLIP-seq
MIRT1388395	hsa-miR-548c-3p	CLIP-seq
MIRT1388396	hsa-miR-574-3p	CLIP-seq
MIRT2632361	hsa-miR-603	CLIP-seq
MIRT2632362	hsa-miR-639	CLIP-seq
MIRT2116365	hsa-miR-642b	CLIP-seq
MIRT1388309	hsa-miR-1254	CLIP-seq
MIRT1388312	hsa-miR-1302	CLIP-seq
MIRT1388317	hsa-miR-150	CLIP-seq
MIRT2632349	hsa-miR-181a	CLIP-seq
MIRT2632350	hsa-miR-181b	CLIP-seq
MIRT2632351	hsa-miR-181c	CLIP-seq
MIRT2632352	hsa-miR-181d	CLIP-seq
MIRT1388320	hsa-miR-193a-5p	CLIP-seq
MIRT1388324	hsa-miR-2113	CLIP-seq
MIRT1388326	hsa-miR-2277-3p	CLIP-seq
MIRT2632353	hsa-miR-23a	CLIP-seq
MIRT2632354	hsa-miR-23b	CLIP-seq
MIRT2632355	hsa-miR-23c	CLIP-seq
MIRT1388329	hsa-miR-3116	CLIP-seq
MIRT1388331	hsa-miR-3120-5p	CLIP-seq
MIRT1388332	hsa-miR-3125	CLIP-seq
MIRT1388334	hsa-miR-3152-5p	CLIP-seq
MIRT1388338	hsa-miR-329	CLIP-seq
MIRT1388339	hsa-miR-342-3p	CLIP-seq
MIRT1388341	hsa-miR-362-3p	CLIP-seq
MIRT1388343	hsa-miR-3680	CLIP-seq
MIRT1388344	hsa-miR-377	CLIP-seq
MIRT1388346	hsa-miR-3909	CLIP-seq
MIRT1388347	hsa-miR-3916	CLIP-seq
MIRT1388348	hsa-miR-3922-5p	CLIP-seq
MIRT1388350	hsa-miR-3937	CLIP-seq
MIRT2632357	hsa-miR-3941	CLIP-seq
MIRT2632359	hsa-miR-4262	CLIP-seq
MIRT1388351	hsa-miR-4265	CLIP-seq
MIRT1388355	hsa-miR-4296	CLIP-seq
MIRT1388356	hsa-miR-4298	CLIP-seq
MIRT1388358	hsa-miR-4322	CLIP-seq
MIRT1388359	hsa-miR-4428	CLIP-seq
MIRT2338885	hsa-miR-4476	CLIP-seq
MIRT1388368	hsa-miR-4528	CLIP-seq
MIRT1388369	hsa-miR-4533	CLIP-seq
MIRT1388370	hsa-miR-4648	CLIP-seq
MIRT1388371	hsa-miR-4654	CLIP-seq
MIRT1388378	hsa-miR-4717-5p	CLIP-seq
MIRT1388381	hsa-miR-4747-5p	CLIP-seq
MIRT1388383	hsa-miR-4753-5p	CLIP-seq
MIRT1388386	hsa-miR-4769-5p	CLIP-seq
MIRT1388387	hsa-miR-4774-3p	CLIP-seq
MIRT1388389	hsa-miR-4789-3p	CLIP-seq
MIRT2632360	hsa-miR-498	CLIP-seq
MIRT1388392	hsa-miR-510	CLIP-seq
MIRT1388393	hsa-miR-511	CLIP-seq
MIRT1388396	hsa-miR-574-3p	CLIP-seq
MIRT2632361	hsa-miR-603	CLIP-seq
MIRT2116365	hsa-miR-642b	CLIP-seq
MIRT1388400	hsa-miR-661	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
ATF6	Unknown	9271374
ELK1	Unknown	15531578
MKL1	Unknown	14565952
NR3C1	Repression	17016446
TEAD1	Unknown	24344135

135

Show/Hide all (135)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	1509260
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	19098903, 20808827
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IGI	23764775
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS
GO:0001569	Process	Branching involved in blood vessel morphogenesis	IEA
GO:0001666	Process	Response to hypoxia	IMP	19098903
GO:0001701	Process	In utero embryonic development	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001707	Process	Mesoderm formation	IEA
GO:0001764	Process	Neuron migration	IEA
GO:0001829	Process	Trophectodermal cell differentiation	IDA	17576768
GO:0001947	Process	Heart looping	IEA
GO:0001947	Process	Heart looping	ISS
GO:0002011	Process	Morphogenesis of an epithelial sheet	IEA
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IEA
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IEA
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IMP	15180964
GO:0002521	Process	Leukocyte differentiation	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	3203386
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IMP	18296735
GO:0005515	Function	Protein binding	IPI	7854423, 8887666, 12397177, 14565952, 17670796, 18497331, 19350017, 25298399
GO:0005634	Component	Nucleus	IDA	2108863
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	15180964
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0007015	Process	Actin filament organization	IEA
GO:0007160	Process	Cell-matrix adhesion	IEA
GO:0007369	Process	Gastrulation	IEA
GO:0007507	Process	Heart development	IEA
GO:0007507	Process	Heart development	ISS
GO:0007616	Process	Long-term memory	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008306	Process	Associative learning	IEA
GO:0009636	Process	Response to toxic substance	TAS	12660819
GO:0009725	Process	Response to hormone	IDA	17975004
GO:0010669	Process	Epithelial structure maintenance	IEA
GO:0010736	Function	Serum response element binding	IBA
GO:0010736	Function	Serum response element binding	IDA	3203386, 23764775
GO:0010736	Function	Serum response element binding	IEA
GO:0021766	Process	Hippocampus development	IEA
GO:0022028	Process	Tangential migration from the subventricular zone to the olfactory bulb	IEA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030036	Process	Actin cytoskeleton organization	ISS
GO:0030038	Process	Contractile actin filament bundle assembly	IEA
GO:0030155	Process	Regulation of cell adhesion	IEA
GO:0030168	Process	Platelet activation	IEA
GO:0030220	Process	Platelet formation	IEA
GO:0030336	Process	Negative regulation of cell migration	IEA
GO:0030878	Process	Thyroid gland development	IEA
GO:0030900	Process	Forebrain development	IEA
GO:0031175	Process	Neuron projection development	IEA
GO:0031490	Function	Chromatin DNA binding	IEA
GO:0034097	Process	Response to cytokine	IMP	15180964
GO:0034097	Process	Response to cytokine	NAS	3203386
GO:0035855	Process	Megakaryocyte development	IEA
GO:0035912	Process	Dorsal aorta morphogenesis	IEA
GO:0042060	Process	Wound healing	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	3203386
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0043149	Process	Stress fiber assembly	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043589	Process	Skin morphogenesis	IEA
GO:0045059	Process	Positive thymic T cell selection	IEA
GO:0045214	Process	Sarcomere organization	IEA
GO:0045597	Process	Positive regulation of cell differentiation	IDA	17576768
GO:0045773	Process	Positive regulation of axon extension	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	17576768
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	3203386, 8887666, 19098903, 19578358
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	19783823
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0045987	Process	Positive regulation of smooth muscle contraction	IDA	17215356
GO:0046016	Process	Positive regulation of transcription by glucose	IEA
GO:0046716	Process	Muscle cell cellular homeostasis	IEA
GO:0046716	Process	Muscle cell cellular homeostasis	ISS
GO:0046847	Process	Filopodium assembly	IEA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048538	Process	Thymus development	IEA
GO:0048589	Process	Developmental growth	IEA
GO:0048666	Process	Neuron development	TAS	17200232
GO:0048675	Process	Axon extension	IEA
GO:0048821	Process	Erythrocyte development	IEA
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IMP	18296735
GO:0051150	Process	Regulation of smooth muscle cell differentiation	TAS	17215356
GO:0051491	Process	Positive regulation of filopodium assembly	IEA
GO:0055003	Process	Cardiac myofibril assembly	IEA
GO:0060055	Process	Angiogenesis involved in wound healing	TAS	15180964
GO:0060218	Process	Hematopoietic stem cell differentiation	IEA
GO:0060261	Process	Positive regulation of transcription initiation by RNA polymerase II	IDA	8887666
GO:0060292	Process	Long-term synaptic depression	IEA
GO:0060324	Process	Face development	IEA
GO:0060347	Process	Heart trabecula formation	IEA
GO:0060379	Process	Cardiac muscle cell myoblast differentiation	IEA
GO:0060379	Process	Cardiac muscle cell myoblast differentiation	IGI	19783823
GO:0060425	Process	Lung morphogenesis	IEA
GO:0060532	Process	Bronchus cartilage development	IEA
GO:0060534	Process	Trachea cartilage development	IEA
GO:0060947	Process	Cardiac vascular smooth muscle cell differentiation	IEA
GO:0061029	Process	Eyelid development in camera-type eye	IEA
GO:0061145	Process	Lung smooth muscle development	IEA
GO:0061436	Process	Establishment of skin barrier	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0070830	Process	Bicellular tight junction assembly	IEA
GO:0070878	Function	Primary miRNA binding	IEA
GO:0070878	Function	Primary miRNA binding	ISS
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0090009	Process	Primitive streak formation	IEA
GO:0090136	Process	Epithelial cell-cell adhesion	IEA
GO:0090398	Process	Cellular senescence	IMP	15282327
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	16054032, 18296735
GO:1900222	Process	Negative regulation of amyloid-beta clearance	IMP	19098903
GO:1902894	Process	Negative regulation of miRNA transcription	IEA
GO:1902894	Process	Negative regulation of miRNA transcription	ISS
GO:1902895	Process	Positive regulation of miRNA transcription	IEA
GO:1902895	Process	Positive regulation of miRNA transcription	IGI	23764775
GO:1902895	Process	Positive regulation of miRNA transcription	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
600589	11291	ENSG00000112658

P11831

Protein name

Serum response factor (SRF)

Protein function

SRF is a transcription factor that binds to the serum response element (SRE), a short sequence of dyad symmetry located 300 bp to the 5' of the site of transcription initiation of some genes (such as FOS). Together with MRTFA transcription coact

PDB

1HBX , 1K6O , 1SRS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00319	SRF-TF	150 → 197	SRF-type transcription factor (DNA-binding and dimerisation domain)	Domain

Sequence

MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREA
AAAAATTPAPTAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMEIGMVVGGPEASAAA
TGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTG
TQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATG
FEETDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPIT
NYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPGGAVAQQVPVQAI
QVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPT
SGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAV
IGQQAGSSSNLTELQVVNLDTAHSTKSE

Sequence length

508

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway cGMP-PKG signaling pathway Human T-cell leukemia virus 1 infection Viral carcinogenesis		RHO GTPases Activate Formins NGF-stimulated transcription Estrogen-dependent nuclear events downstream of ESR-membrane signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARDIOMYOPATHIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DISEASE	—	ClinGen, Disgenet, GWAS catalog ClinGen, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HIV INFECTIONS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (48)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Acidosis	Associate	40217316	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	31323040	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Associate	34185408	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Associate	25523945	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	17934210, 21670154, 26179713, 26885614, 31894257	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis Cutis	Associate	36509758	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Associate	23576568	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	36421692	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Associate	34067464	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Associate	25338953	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Associate	34185408	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Associate	31815603	★★★★★ ★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	36059456	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Associate	33083497	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Associate	34417138	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrocartilaginous embolism	Associate	31638828	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Associate	21192842	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Inhibit	21410985	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Associate	34185408	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Associate	21192842, 25028927	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoma Adult T Cell	Associate	35504920	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Megakaryoblastic Acute	Associate	28546428	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscle Neoplasms	Associate	32187044	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Diseases	Associate	21998125	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Associate	21893058	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myofibroma	Associate	28248815, 31478943, 33830670	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopericytoma	Associate	28248815, 31478943	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonia with Skeletal Abnormalities and Mental Retardation	Associate	21998125	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	23707258, 25009298, 26250344, 28249598, 28900514	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Stimulate	25080937	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	26639992, 27532209, 29934435, 31478943, 32187044, 36421692, 36509758	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	31414556	★★★★★ ★☆☆☆☆ Found in Text Mining only
Norrie disease	Associate	32041280	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	27695057	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Associate	35397550	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	21622724, 23576568, 26250344, 28249598, 37377210, 37385752, 37582751	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms Castration Resistant	Associate	26250344, 37377210	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatitis	Associate	37385752	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Associate	21998125	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Associate	32187044	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rupture	Associate	36303246	★★★★★ ★☆☆☆☆ Found in Text Mining only
Smith McCort Dysplasia	Associate	31815603	★★★★★ ★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Associate	28248815, 36421692	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	25009298, 25080937, 28251884, 28900514	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Ulcer	Associate	21410985	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Associate	30337297	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Associate	30272326	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Associate	28258189	★★★★★ ★☆☆☆☆ Found in Text Mining only

SRF (serum response factor)