Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6721
Gene name Gene Name - the full gene name approved by the HGNC.	Sterol regulatory element binding transcription factor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SREBF2
Synonyms (NCBI Gene) Gene synonyms aliases	SREBP-2, SREBP2, bHLHd2
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q13.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the a ubiquitously expressed transcription factor that controls cholesterol homeostasis by regulating transcription of sterol-regulated genes. The encoded protein contains a basic helix-loop-helix-leucine zipper (bHLH-Zip) do

Show/Hide all(173)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018283	hsa-miR-335-5p	Microarray	18185580
MIRT050003	hsa-miR-28-5p	CLASH	23622248
MIRT049508	hsa-miR-92a-3p	CLASH	23622248
MIRT043540	hsa-miR-331-3p	CLASH	23622248
MIRT037293	hsa-miR-877-5p	CLASH	23622248
MIRT054226	hsa-miR-128-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23990020
MIRT438068	hsa-miR-185-5p	Luciferase reporter assay, qRT-PCR, Western blot	23951060
MIRT438067	hsa-miR-342-3p	Luciferase reporter assay, qRT-PCR, Western blot	23951060
MIRT438068	hsa-miR-185-5p	Luciferase reporter assay, qRT-PCR, Western blot	23951060
MIRT438067	hsa-miR-342-3p	Luciferase reporter assay, qRT-PCR, Western blot	23951060
MIRT467167	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT467166	hsa-miR-4688	PAR-CLIP	23592263
MIRT467165	hsa-miR-6743-5p	PAR-CLIP	23592263
MIRT467164	hsa-miR-6504-3p	PAR-CLIP	23592263
MIRT467163	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT467162	hsa-miR-3937	PAR-CLIP	23592263
MIRT467160	hsa-miR-7112-5p	PAR-CLIP	23592263
MIRT467161	hsa-miR-4693-3p	PAR-CLIP	23592263
MIRT467159	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT438068	hsa-miR-185-5p	PAR-CLIP	23592263
MIRT467158	hsa-miR-4306	PAR-CLIP	23592263
MIRT467157	hsa-miR-4644	PAR-CLIP	23592263
MIRT467156	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT467155	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT467154	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT467153	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT467152	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT467151	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT467150	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT467149	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT467148	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT467147	hsa-miR-101-3p	PAR-CLIP	23592263
MIRT467146	hsa-miR-582-5p	PAR-CLIP	23592263
MIRT467145	hsa-miR-6824-5p	PAR-CLIP	23592263
MIRT443801	hsa-miR-365b-3p	PAR-CLIP	22100165
MIRT443800	hsa-miR-365a-3p	PAR-CLIP	22100165
MIRT443799	hsa-miR-5692a	PAR-CLIP	22100165
MIRT443798	hsa-miR-5189-3p	PAR-CLIP	22100165
MIRT439546	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439546	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT438068	hsa-miR-185-5p	Luciferase reporter assay, qRT-PCR, Western blot	25914460
MIRT050003	hsa-miR-28-5p	Luciferase reporter assay, Western blotting, qRT-PCR	32028704
MIRT467167	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT467166	hsa-miR-4688	PAR-CLIP	23592263
MIRT467165	hsa-miR-6743-5p	PAR-CLIP	23592263
MIRT467164	hsa-miR-6504-3p	PAR-CLIP	23592263
MIRT467163	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT467162	hsa-miR-3937	PAR-CLIP	23592263
MIRT467160	hsa-miR-7112-5p	PAR-CLIP	23592263
MIRT467161	hsa-miR-4693-3p	PAR-CLIP	23592263
MIRT467159	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT438068	hsa-miR-185-5p	PAR-CLIP	23592263
MIRT467158	hsa-miR-4306	PAR-CLIP	23592263
MIRT467157	hsa-miR-4644	PAR-CLIP	23592263
MIRT467156	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT467155	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT467154	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT467153	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT467152	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT467151	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT467150	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT467149	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT467148	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT467147	hsa-miR-101-3p	PAR-CLIP	23592263
MIRT467146	hsa-miR-582-5p	PAR-CLIP	23592263
MIRT467145	hsa-miR-6824-5p	PAR-CLIP	23592263
MIRT443801	hsa-miR-365b-3p	PAR-CLIP	22100165
MIRT443800	hsa-miR-365a-3p	PAR-CLIP	22100165
MIRT443799	hsa-miR-5692a	PAR-CLIP	22100165
MIRT443798	hsa-miR-5189-3p	PAR-CLIP	22100165
MIRT1387997	hsa-miR-1224-3p	CLIP-seq
MIRT1387998	hsa-miR-1226	CLIP-seq
MIRT1387999	hsa-miR-1236	CLIP-seq
MIRT1388000	hsa-miR-1260	CLIP-seq
MIRT1388001	hsa-miR-1260b	CLIP-seq
MIRT1388002	hsa-miR-1280	CLIP-seq
MIRT1388003	hsa-miR-2277-3p	CLIP-seq
MIRT1388004	hsa-miR-2355-5p	CLIP-seq
MIRT1388005	hsa-miR-324-5p	CLIP-seq
MIRT1388006	hsa-miR-365	CLIP-seq
MIRT1388007	hsa-miR-3653	CLIP-seq
MIRT1388008	hsa-miR-4286	CLIP-seq
MIRT1388009	hsa-miR-4313	CLIP-seq
MIRT1388010	hsa-miR-4639-3p	CLIP-seq
MIRT1388011	hsa-miR-4650-5p	CLIP-seq
MIRT1388012	hsa-miR-532-3p	CLIP-seq
MIRT1554145	hsa-miR-185	CLIP-seq
MIRT1554146	hsa-miR-3175	CLIP-seq
MIRT1554147	hsa-miR-3184	CLIP-seq
MIRT1554148	hsa-miR-423-5p	CLIP-seq
MIRT1554149	hsa-miR-4663	CLIP-seq
MIRT1554150	hsa-miR-4716-3p	CLIP-seq
MIRT1554151	hsa-miR-4723-5p	CLIP-seq
MIRT1554152	hsa-miR-4728-3p	CLIP-seq
MIRT1554153	hsa-miR-539	CLIP-seq
MIRT1554145	hsa-miR-185	CLIP-seq
MIRT2116248	hsa-miR-1913	CLIP-seq
MIRT2116249	hsa-miR-324-3p	CLIP-seq
MIRT1388005	hsa-miR-324-5p	CLIP-seq
MIRT2116250	hsa-miR-4264	CLIP-seq
MIRT1388010	hsa-miR-4639-3p	CLIP-seq
MIRT1388011	hsa-miR-4650-5p	CLIP-seq
MIRT2116251	hsa-miR-4704-3p	CLIP-seq
MIRT1554152	hsa-miR-4728-3p	CLIP-seq
MIRT1387997	hsa-miR-1224-3p	CLIP-seq
MIRT1387998	hsa-miR-1226	CLIP-seq
MIRT2338775	hsa-miR-125a-3p	CLIP-seq
MIRT1388000	hsa-miR-1260	CLIP-seq
MIRT1388001	hsa-miR-1260b	CLIP-seq
MIRT1388002	hsa-miR-1280	CLIP-seq
MIRT2338776	hsa-miR-1292	CLIP-seq
MIRT1554145	hsa-miR-185	CLIP-seq
MIRT2116248	hsa-miR-1913	CLIP-seq
MIRT2338777	hsa-miR-1915	CLIP-seq
MIRT2338778	hsa-miR-193a-3p	CLIP-seq
MIRT2338779	hsa-miR-193b	CLIP-seq
MIRT2338780	hsa-miR-1972	CLIP-seq
MIRT1388003	hsa-miR-2277-3p	CLIP-seq
MIRT2338781	hsa-miR-24	CLIP-seq
MIRT2338782	hsa-miR-2681	CLIP-seq
MIRT2338783	hsa-miR-3120-3p	CLIP-seq
MIRT2338784	hsa-miR-3123	CLIP-seq
MIRT2338785	hsa-miR-3136-3p	CLIP-seq
MIRT1554146	hsa-miR-3175	CLIP-seq
MIRT2338786	hsa-miR-3176	CLIP-seq
MIRT1554147	hsa-miR-3184	CLIP-seq
MIRT2338787	hsa-miR-3194-3p	CLIP-seq
MIRT2116249	hsa-miR-324-3p	CLIP-seq
MIRT2338788	hsa-miR-342-5p	CLIP-seq
MIRT2338789	hsa-miR-3665	CLIP-seq
MIRT2338790	hsa-miR-3677-5p	CLIP-seq
MIRT2338791	hsa-miR-3922-3p	CLIP-seq
MIRT2338792	hsa-miR-3936	CLIP-seq
MIRT2338793	hsa-miR-3945	CLIP-seq
MIRT1554148	hsa-miR-423-5p	CLIP-seq
MIRT2338794	hsa-miR-4253	CLIP-seq
MIRT2116250	hsa-miR-4264	CLIP-seq
MIRT2338795	hsa-miR-4270	CLIP-seq
MIRT2338796	hsa-miR-4283	CLIP-seq
MIRT2338797	hsa-miR-4441	CLIP-seq
MIRT2338798	hsa-miR-4470	CLIP-seq
MIRT2338799	hsa-miR-4477b	CLIP-seq
MIRT2338800	hsa-miR-4481	CLIP-seq
MIRT1388011	hsa-miR-4650-5p	CLIP-seq
MIRT1554149	hsa-miR-4663	CLIP-seq
MIRT2338801	hsa-miR-4664-5p	CLIP-seq
MIRT2116251	hsa-miR-4704-3p	CLIP-seq
MIRT1554150	hsa-miR-4716-3p	CLIP-seq
MIRT1554151	hsa-miR-4723-5p	CLIP-seq
MIRT1554152	hsa-miR-4728-3p	CLIP-seq
MIRT2338802	hsa-miR-4736	CLIP-seq
MIRT2338803	hsa-miR-4745-5p	CLIP-seq
MIRT2338804	hsa-miR-4758-5p	CLIP-seq
MIRT1388012	hsa-miR-532-3p	CLIP-seq
MIRT1554153	hsa-miR-539	CLIP-seq
MIRT2338805	hsa-miR-542-3p	CLIP-seq
MIRT2338806	hsa-miR-548v	CLIP-seq
MIRT2338807	hsa-miR-646	CLIP-seq
MIRT2338808	hsa-miR-663b	CLIP-seq
MIRT2338809	hsa-miR-760	CLIP-seq
MIRT2338777	hsa-miR-1915	CLIP-seq
MIRT2632217	hsa-miR-1291	CLIP-seq
MIRT2632218	hsa-miR-3183	CLIP-seq
MIRT2632219	hsa-miR-3619-3p	CLIP-seq
MIRT2632220	hsa-miR-3690	CLIP-seq
MIRT2338793	hsa-miR-3945	CLIP-seq
MIRT2338794	hsa-miR-4253	CLIP-seq
MIRT2632221	hsa-miR-4308	CLIP-seq
MIRT2632222	hsa-miR-4715-3p	CLIP-seq
MIRT2632223	hsa-miR-4723-3p	CLIP-seq
MIRT2632224	hsa-miR-4733-3p	CLIP-seq
MIRT2632225	hsa-miR-4776-5p	CLIP-seq
MIRT2632226	hsa-miR-591	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
PPARA	Repression	16946405

Show/Hide all(67)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	15358760
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	19098903
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0000247	Function	C-8 sterol isomerase activity	IDA	12941800
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	15358760
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	12177166, 32322062, 38503280
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IMP	32497488
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	15358760
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IMP	19098903
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	9242699, 10976766, 12855700, 16799563, 19706601, 20936779, 22265415, 28514442, 32296183, 33961781, 34819669
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	12202038, 12242332, 12941800, 15358760, 19098903, 32322062
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IMP	32497488
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	12941800, 19098903
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	12202038, 12941800
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	32322062
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	TAS	7903453
GO:0008202	Process	Steroid metabolic process	IEA
GO:0008203	Process	Cholesterol metabolic process	IEA
GO:0008593	Process	Regulation of Notch signaling pathway	ISS
GO:0009267	Process	Cellular response to starvation	IMP	25339898
GO:0010886	Process	Positive regulation of cholesterol storage	IBA
GO:0010886	Process	Positive regulation of cholesterol storage	IDA	15358760
GO:0012507	Component	ER to Golgi transport vesicle membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032933	Process	SREBP signaling pathway	IDA	27614840, 32322062
GO:0032933	Process	SREBP signaling pathway	IEA
GO:0032933	Process	SREBP signaling pathway	IMP	27614840
GO:0032937	Component	SREBP-SCAP-Insig complex	IDA	12202038, 12242332
GO:0042632	Process	Cholesterol homeostasis	IEA
GO:0045542	Process	Positive regulation of cholesterol biosynthetic process	IDA	12177166, 32322062, 38503280
GO:0045542	Process	Positive regulation of cholesterol biosynthetic process	IEA
GO:0045542	Process	Positive regulation of cholesterol biosynthetic process	IMP	12177166
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12446768
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12242332
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0070888	Function	E-box binding	IDA	15358760
GO:0071404	Process	Cellular response to low-density lipoprotein particle stimulus	IEP	15358760
GO:0071499	Process	Cellular response to laminar fluid shear stress	NAS	15358760
GO:0090370	Process	Negative regulation of cholesterol efflux	IDA	15358760
GO:1900222	Process	Negative regulation of amyloid-beta clearance	IMP	19098903
GO:1901524	Process	Regulation of mitophagy	HMP	24912190
GO:1902895	Process	Positive regulation of miRNA transcription	IEA
GO:1903955	Process	Positive regulation of protein targeting to mitochondrion	HMP	24912190
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
600481	11290	ENSG00000198911

Protein

UniProt ID

Q12772

Protein name

Sterol regulatory element-binding protein 2 (SREBP-2) (Class D basic helix-loop-helix protein 2) (bHLHd2) (Sterol regulatory element-binding transcription factor 2) [Cleaved into: Processed sterol regulatory element-binding protein 2 (Transcription factor

Protein function

[Sterol regulatory element-binding protein 2]: Precursor of the transcription factor form (Processed sterol regulatory element-binding protein 2), which is embedded in the endoplasmic reticulum membrane (PubMed:32322062). Low sterol concentratio

PDB

1UKL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	331 → 381	Helix-loop-helix DNA-binding domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed in adult and fetal tissues. {ECO:0000269|PubMed:7903453}.

Sequence

MDDSGELGGLETMETLTELGDELTLGDIDEMLQFVSNQVGEFPDLFSEQLCSSFPGSGGS
GSSSGSSGSSSSSSNGRGSSSGAVDPSVQRSFTQVTLPSFSPSAASPQAPTLQVKVSPTS
VPTTPRATPILQPRPQPQPQPQTQLQQQTVMITPTFSTTPQTRIIQQPLIYQNAATSFQV
LQPQVQSLVTSSQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQVP
VLVQPQIIKTDSLVLTTLKTDGSPVMAAVQNPALTALTTPIQTAALQVPTLVGSSGTILT
TMPVMMGQEKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIELKDLVMGT
DAKMHKSGVLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNEVDLK
IEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRS
RILLCVLTFLCLSFNPLTSLLQWGGAHDSDQHPHSGSGRSVLSFESGSGGWFDWMMPTLL
LWLVNGVIVLSVFVKLLVHGEPVIRPHSRSSVTFWRHRKQADLDLARGDFAAAAGNLQTC
LAVLGRALPTSRLDLACSLSWNVIRYSLQKLRLVRWLLKKVFQCRRATPATEAGFEDEAK
TSARDAALAYHRLHQLHITGKLPAGSACSDVHMALCAVNLAECAEEKIPPSTLVEIHLTA
AMGLKTRCGGKLGFLASYFLSRAQSLCGPEHSAVPDSLRWLCHPLGQKFFMERSWSVKSA
AKESLYCAQRNPADPIAQVHQAFCKNLLERAIESLVKPQAKKKAGDQEEESCEFSSALEY
LKLLHSFVDSVGVMSPPLSRSSVLKSALGPDIICRWWTSAITVAISWLQGDDAAVRSHFT
KVERIPKALEVTESPLVKAIFHACRAMHASLPGKADGQQSSFCHCERASGHLWSSLNVSG
ATSDPALNHVVQLLTCDLLLSLRTALWQKQASASQAVGETYHASGAELAGFQRDLGSLRR
LAHSFRPAYRKVFLHEATVRLMAGASPTRTHQLLEHSLRRRTTQSTKHGEVDAWPGQRER
ATAILLACRHLPLSFLSSPGQRAVLLAEAARTLEKVGDRRSCNDCQQMIVKLGGGTAIAA
S

Sequence length

1141

Interactions

View interactions

	Reactome
			Regulation of cholesterol biosynthesis by SREBP (SREBF) PPARA activates gene expression Activation of gene expression by SREBF (SREBP) EGR2 and SOX10-mediated initiation of Schwann cell myelination

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Hypothyroidism	Hypothyroidism	N/A	N/A	GWAS
Multiple Congenital Anomalies	multiple congenital anomalies/dysmorphic syndrome	N/A	N/A	GenCC
Schizophrenia	Schizophrenia	N/A	N/A	GWAS
Spastic Paraplegia	hereditary spastic paraplegia	N/A	N/A	GenCC

Show/Hide Text Mining Associations (73)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acrocephalosyndactylia	Associate	31490983
Acute Coronary Syndrome	Associate	31490983
Adenomatous Polyposis Coli	Inhibit	29866653
Alzheimer Disease	Inhibit	22414021
Alzheimer Disease	Associate	33920138
Amyotrophic Lateral Sclerosis	Associate	31861978
Atherosclerosis	Associate	19292868, 23717417
Autoimmune Lymphoproliferative Syndrome	Stimulate	38588613
Breast Neoplasms	Associate	26317411
Carcinogenesis	Associate	31432128
Carcinoma Hepatocellular	Associate	35642354
Carcinoma Pancreatic Ductal	Associate	35619540
Carotid Stenosis	Associate	31610782
Cell Transformation Neoplastic	Associate	29328367
Cerebral Infarction	Associate	22429355
Chemical and Drug Induced Liver Injury	Associate	22754327
Cholelithiasis	Associate	23577061
Cholesterol pneumonia	Associate	27703009
Colorectal Neoplasms	Associate	22465712, 37661645
Congenital Hyperinsulinism	Stimulate	20699619
Constriction Pathologic	Stimulate	30673762
Coronary Artery Disease	Associate	28367087
Coronary Artery Disease	Stimulate	32323776
Coronary Disease	Stimulate	30673762
Coronary Stenosis	Associate	30673762
COVID 19	Associate	32883951
COVID 19	Stimulate	37669865
Cytokine Release Syndrome	Associate	32883951
Diabetes Mellitus	Associate	22828168, 23274901
Diabetes Mellitus	Stimulate	28367087
Diabetes Mellitus Type 2	Associate	19292868
Drug Related Side Effects and Adverse Reactions	Associate	25134999
Dyslipidemias	Associate	35899893
Embolism Fat	Associate	23274901
Esophageal Squamous Cell Carcinoma	Stimulate	31432128
Glioblastoma	Associate	36934350
Glioma	Associate	31746143, 36934350, 38070488
Glucose Intolerance	Associate	20699619
Hyperlipidemias	Associate	15547298, 23274901
Hyperlipoproteinemia Type II	Associate	15547298, 32811528
Hypoxia	Stimulate	37377965
Inflammation	Associate	23115640, 27703009, 35959888
Inflammation	Stimulate	28100270, 32883951
Insulin Resistance	Associate	23274901
Insulinoma	Associate	23274901
Intestinal Diseases	Inhibit	27703009
Leukemia	Associate	38030791
Leukoencephalopathies	Associate	31691183
Liver Diseases	Associate	23274901
Lung Diseases	Associate	32883951
Melanoma	Associate	30970006, 33203734, 35408842
Metabolic Syndrome	Associate	23274901
Multiple Myeloma	Associate	34378191, 37859702
Neoplasm Metastasis	Associate	33203734, 39851231
Neoplasms	Associate	22465712, 29466876, 32028704, 33203734, 35408842, 35619540, 36934350, 39342037
Neoplasms	Stimulate	31432128
Neoplasms Glandular and Epithelial	Associate	27703009
Non alcoholic Fatty Liver Disease	Associate	22182810, 22560219, 23274901, 23931760, 28902428, 29336468
Obesity	Associate	19292868, 25028659
Osteoarthritis	Associate	22662110, 24496149, 25880168
Osteoarthritis	Stimulate	22662110
Osteoarthritis Knee	Associate	24496149
Osteonecrosis	Associate	18954446
Osteosarcoma	Associate	30466075
Ovarian Neoplasms	Associate	25134999, 29466876, 34823420, 38166541
Plaque Atherosclerotic	Stimulate	23717417
Plaque Atherosclerotic	Associate	31490983
Pneumonia Lipid	Stimulate	23717417
Pneumonia Lipid	Associate	31827541
Prostatic Neoplasms	Associate	20041144, 25294820, 32028704, 33780364
Sitosterolemia	Associate	9610773
Urinary Bladder Neoplasms	Associate	24382701
Virus Diseases	Associate	32883951

SREBF2 (sterol regulatory element binding transcription factor 2)