Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6715
Gene name Gene Name - the full gene name approved by the HGNC.
Steroid 5 alpha-reductase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SRD5A1
Synonyms (NCBI Gene) Gene synonyms aliases
S5AR 1
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5p15.31
Summary Summary of gene provided in NCBI Entrez Gene.
Steroid 5-alpha-reductase (EC 1.3.99.5) catalyzes the conversion of testosterone into the more potent androgen, dihydrotestosterone (DHT). Also see SRD5A2 (MIM 607306).[supplied by OMIM, Mar 2008]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024451 hsa-miR-215-5p Microarray 19074876
MIRT026876 hsa-miR-192-5p Microarray 19074876
MIRT711475 hsa-miR-148a-5p HITS-CLIP 19536157
MIRT711474 hsa-miR-28-5p HITS-CLIP 19536157
MIRT711473 hsa-miR-3139 HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001655 Process Urogenital system development IEA
GO:0001889 Process Liver development IEA
GO:0003865 Function 3-oxo-5-alpha-steroid 4-dehydrogenase activity IBA
GO:0003865 Function 3-oxo-5-alpha-steroid 4-dehydrogenase activity IDA 17986282
GO:0003865 Function 3-oxo-5-alpha-steroid 4-dehydrogenase activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
184753 11284 ENSG00000145545
Protein
UniProt ID P18405
Protein name 3-oxo-5-alpha-steroid 4-dehydrogenase 1 (EC 1.3.1.22) (SR type 1) (Steroid 5-alpha-reductase 1) (S5AR 1)
Protein function Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02544 Steroid_dh 110 259 3-oxo-5-alpha-steroid 4-dehydrogenase Family
Tissue specificity TISSUE SPECIFICITY: Liver and prostate (at a low level).
Sequence
MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQE
LPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMA
IMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGD
TGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWY
LRKFEEYPKFRKIIIPFLF
Sequence length 259
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Steroid hormone biosynthesis
Metabolic pathways
  Androgen biosynthesis
<