Gene Gene information from NCBI Gene database.
Entrez ID 6715
Gene name Steroid 5 alpha-reductase 1
Gene symbol SRD5A1
Synonyms (NCBI Gene)
S5AR 1
Chromosome 5
Chromosome location 5p15.31
Summary Steroid 5-alpha-reductase (EC 1.3.99.5) catalyzes the conversion of testosterone into the more potent androgen, dihydrotestosterone (DHT). Also see SRD5A2 (MIM 607306).[supplied by OMIM, Mar 2008]
miRNA miRNA information provided by mirtarbase database.
298
miRTarBase ID miRNA Experiments Reference
MIRT024451 hsa-miR-215-5p Microarray 19074876
MIRT026876 hsa-miR-192-5p Microarray 19074876
MIRT711475 hsa-miR-148a-5p HITS-CLIP 19536157
MIRT711474 hsa-miR-28-5p HITS-CLIP 19536157
MIRT711473 hsa-miR-3139 HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
63
GO ID Ontology Definition Evidence Reference
GO:0001655 Process Urogenital system development IEA
GO:0001889 Process Liver development IEA
GO:0003865 Function 3-oxo-5-alpha-steroid 4-dehydrogenase activity IBA
GO:0003865 Function 3-oxo-5-alpha-steroid 4-dehydrogenase activity IDA 17986282
GO:0003865 Function 3-oxo-5-alpha-steroid 4-dehydrogenase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
184753 11284 ENSG00000145545
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P18405
Protein name 3-oxo-5-alpha-steroid 4-dehydrogenase 1 (EC 1.3.1.22) (SR type 1) (Steroid 5-alpha-reductase 1) (S5AR 1)
Protein function Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02544 Steroid_dh 110 259 3-oxo-5-alpha-steroid 4-dehydrogenase Family
Tissue specificity TISSUE SPECIFICITY: Liver and prostate (at a low level).
Sequence
MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQE
LPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMA
IMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGD
TGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWY
LRKFEEYPKFRKIIIPFLF
Sequence length 259
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Steroid hormone biosynthesis
Metabolic pathways
  Androgen biosynthesis
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Ovarian serous cystadenocarcinoma Uncertain significance rs201816903 RCV005927166
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alcoholism Associate 21323680
Alopecia Associate 36460729
Breast Neoplasms Associate 15212687
Calcinosis Cutis Stimulate 22971343
Cardiac Output Low Associate 34788622
Disorders of Sex Development Associate 35432193
Hirsutism Associate 21676395
Hyperandrogenism Associate 16100771
Metabolic Syndrome Associate 29084161
Neoplasm Metastasis Associate 24244276