Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6714
Gene name Gene Name - the full gene name approved by the HGNC.	SRC proto-oncogene, non-receptor tyrosine kinase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SRC
Synonyms (NCBI Gene) Gene synonyms aliases	ASV, SRC1, THC6, c-SRC, p60-Src
Disease Acronyms (UniProt) Disease acronyms from UniProt database	THC6
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20q11.23
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibi

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121913314	C>T	Likely-pathogenic, pathogenic	Stop gained, coding sequence variant
rs879255268	G>A	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant

Show/Hide all(165)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007051	hsa-miR-23b-3p	Luciferase reporter assay	23074286
MIRT007357	hsa-miR-33a-5p	Immunofluorescence, Luciferase reporter assay, Western blot	23547260
MIRT007357	hsa-miR-33a-5p	Immunofluorescence, Luciferase reporter assay, Western blot	23547260
MIRT024971	hsa-miR-205-5p	Reporter assay	21330408
MIRT053284	hsa-miR-203a-3p	Immunoprecipitaion, qRT-PCR, Western blot	23462723
MIRT053284	hsa-miR-203a-3p	Microarray	23807165
MIRT053592	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23790975
MIRT053284	hsa-miR-203a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23790975
MIRT053750	hsa-miR-31-5p	Immunoblot, Immunohistochemistry, Luciferase reporter assay, qRT-PCR	22948084
MIRT053592	hsa-miR-34a-5p	Immunoblot, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR	23533633
MIRT054922	hsa-miR-33b-5p	Luciferase reporter assay, qRT-PCR	23716591
MIRT053592	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26676753
MIRT053592	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26676753
MIRT053592	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26676753
MIRT755589	hsa-miR-5703	Luciferase reporter assay, Western blotting, qRT-PCR, Immunohistochemistry (IHC), Immunofluorescence	34976193
MIRT1387602	hsa-miR-1207-5p	CLIP-seq
MIRT1387603	hsa-miR-1208	CLIP-seq
MIRT1387604	hsa-miR-1225-5p	CLIP-seq
MIRT1387605	hsa-miR-1253	CLIP-seq
MIRT1387606	hsa-miR-1283	CLIP-seq
MIRT1387607	hsa-miR-141	CLIP-seq
MIRT1387608	hsa-miR-1976	CLIP-seq
MIRT1387609	hsa-miR-200a	CLIP-seq
MIRT1387610	hsa-miR-2355-5p	CLIP-seq
MIRT1387611	hsa-miR-2964a-5p	CLIP-seq
MIRT1387612	hsa-miR-3189-3p	CLIP-seq
MIRT1387613	hsa-miR-3667-3p	CLIP-seq
MIRT1387614	hsa-miR-3918	CLIP-seq
MIRT1387615	hsa-miR-3945	CLIP-seq
MIRT1387616	hsa-miR-4253	CLIP-seq
MIRT1387617	hsa-miR-4286	CLIP-seq
MIRT1387618	hsa-miR-4434	CLIP-seq
MIRT1387619	hsa-miR-4512	CLIP-seq
MIRT1387620	hsa-miR-4516	CLIP-seq
MIRT1387621	hsa-miR-4736	CLIP-seq
MIRT1387622	hsa-miR-4757-5p	CLIP-seq
MIRT1387623	hsa-miR-4763-3p	CLIP-seq
MIRT1387624	hsa-miR-555	CLIP-seq
MIRT1387625	hsa-miR-635	CLIP-seq
MIRT1387626	hsa-miR-1	CLIP-seq
MIRT1387627	hsa-miR-1204	CLIP-seq
MIRT1387603	hsa-miR-1208	CLIP-seq
MIRT1387628	hsa-miR-1225-3p	CLIP-seq
MIRT1387604	hsa-miR-1225-5p	CLIP-seq
MIRT1387629	hsa-miR-1233	CLIP-seq
MIRT1387605	hsa-miR-1253	CLIP-seq
MIRT1387606	hsa-miR-1283	CLIP-seq
MIRT1387630	hsa-miR-1299	CLIP-seq
MIRT1387607	hsa-miR-141	CLIP-seq
MIRT1387631	hsa-miR-184	CLIP-seq
MIRT1387609	hsa-miR-200a	CLIP-seq
MIRT1387632	hsa-miR-206	CLIP-seq
MIRT1387633	hsa-miR-2110	CLIP-seq
MIRT1387634	hsa-miR-214	CLIP-seq
MIRT1387635	hsa-miR-3136-5p	CLIP-seq
MIRT1387636	hsa-miR-3173-3p	CLIP-seq
MIRT1387612	hsa-miR-3189-3p	CLIP-seq
MIRT1387637	hsa-miR-338-5p	CLIP-seq
MIRT1387638	hsa-miR-342-5p	CLIP-seq
MIRT1387639	hsa-miR-346	CLIP-seq
MIRT1387640	hsa-miR-3605-3p	CLIP-seq
MIRT1387641	hsa-miR-3619-5p	CLIP-seq
MIRT1387642	hsa-miR-3673	CLIP-seq
MIRT1387643	hsa-miR-3690	CLIP-seq
MIRT1387644	hsa-miR-378	CLIP-seq
MIRT1387645	hsa-miR-378b	CLIP-seq
MIRT1387646	hsa-miR-378c	CLIP-seq
MIRT1387647	hsa-miR-378d	CLIP-seq
MIRT1387648	hsa-miR-378e	CLIP-seq
MIRT1387649	hsa-miR-378f	CLIP-seq
MIRT1387650	hsa-miR-378h	CLIP-seq
MIRT1387651	hsa-miR-378i	CLIP-seq
MIRT1387614	hsa-miR-3918	CLIP-seq
MIRT1387615	hsa-miR-3945	CLIP-seq
MIRT1387652	hsa-miR-3973	CLIP-seq
MIRT1387653	hsa-miR-422a	CLIP-seq
MIRT1387616	hsa-miR-4253	CLIP-seq
MIRT1387654	hsa-miR-4254	CLIP-seq
MIRT1387655	hsa-miR-4271	CLIP-seq
MIRT1387656	hsa-miR-4276	CLIP-seq
MIRT1387657	hsa-miR-4288	CLIP-seq
MIRT1387658	hsa-miR-4419a	CLIP-seq
MIRT1387618	hsa-miR-4434	CLIP-seq
MIRT1387659	hsa-miR-4439	CLIP-seq
MIRT1387660	hsa-miR-4459	CLIP-seq
MIRT1387661	hsa-miR-4510	CLIP-seq
MIRT1387619	hsa-miR-4512	CLIP-seq
MIRT1387662	hsa-miR-4514	CLIP-seq
MIRT1387620	hsa-miR-4516	CLIP-seq
MIRT1387663	hsa-miR-4533	CLIP-seq
MIRT1387664	hsa-miR-4651	CLIP-seq
MIRT1387665	hsa-miR-4664-5p	CLIP-seq
MIRT1387666	hsa-miR-4685-5p	CLIP-seq
MIRT1387667	hsa-miR-4690-5p	CLIP-seq
MIRT1387668	hsa-miR-4692	CLIP-seq
MIRT1387669	hsa-miR-4695-5p	CLIP-seq
MIRT1387670	hsa-miR-4699-3p	CLIP-seq
MIRT1387671	hsa-miR-4725-3p	CLIP-seq
MIRT1387672	hsa-miR-4731-5p	CLIP-seq
MIRT1387673	hsa-miR-4747-5p	CLIP-seq
MIRT1387674	hsa-miR-4751	CLIP-seq
MIRT1387675	hsa-miR-4765	CLIP-seq
MIRT1387676	hsa-miR-4779	CLIP-seq
MIRT1387677	hsa-miR-4782-5p	CLIP-seq
MIRT1387678	hsa-miR-4795-5p	CLIP-seq
MIRT1387679	hsa-miR-4804-5p	CLIP-seq
MIRT1387680	hsa-miR-491-5p	CLIP-seq
MIRT1387681	hsa-miR-516b	CLIP-seq
MIRT1387682	hsa-miR-518a-5p	CLIP-seq
MIRT1387683	hsa-miR-527	CLIP-seq
MIRT1387684	hsa-miR-548k	CLIP-seq
MIRT1387685	hsa-miR-548l	CLIP-seq
MIRT1387624	hsa-miR-555	CLIP-seq
MIRT1387686	hsa-miR-608	CLIP-seq
MIRT1387687	hsa-miR-613	CLIP-seq
MIRT1387688	hsa-miR-632	CLIP-seq
MIRT1387625	hsa-miR-635	CLIP-seq
MIRT1387689	hsa-miR-654-3p	CLIP-seq
MIRT1387690	hsa-miR-665	CLIP-seq
MIRT1387691	hsa-miR-720	CLIP-seq
MIRT1387692	hsa-miR-759	CLIP-seq
MIRT1387693	hsa-miR-760	CLIP-seq
MIRT1387694	hsa-miR-761	CLIP-seq
MIRT1387695	hsa-miR-940	CLIP-seq
MIRT1387696	hsa-miR-943	CLIP-seq
MIRT1387602	hsa-miR-1207-5p	CLIP-seq
MIRT1387623	hsa-miR-4763-3p	CLIP-seq
MIRT1387602	hsa-miR-1207-5p	CLIP-seq
MIRT2116133	hsa-miR-1254	CLIP-seq
MIRT2116134	hsa-miR-1281	CLIP-seq
MIRT2116135	hsa-miR-2682	CLIP-seq
MIRT2116136	hsa-miR-3064-3p	CLIP-seq
MIRT2116137	hsa-miR-3116	CLIP-seq
MIRT1387614	hsa-miR-3918	CLIP-seq
MIRT2116138	hsa-miR-449c	CLIP-seq
MIRT2116139	hsa-miR-4707-3p	CLIP-seq
MIRT2116140	hsa-miR-4714-5p	CLIP-seq
MIRT1387623	hsa-miR-4763-3p	CLIP-seq
MIRT2116141	hsa-miR-486-3p	CLIP-seq
MIRT1387695	hsa-miR-940	CLIP-seq
MIRT2338550	hsa-miR-153	CLIP-seq
MIRT2338551	hsa-miR-1909	CLIP-seq
MIRT1387634	hsa-miR-214	CLIP-seq
MIRT1387641	hsa-miR-3619-5p	CLIP-seq
MIRT1387655	hsa-miR-4271	CLIP-seq
MIRT1387663	hsa-miR-4533	CLIP-seq
MIRT2338552	hsa-miR-4643	CLIP-seq
MIRT1387671	hsa-miR-4725-3p	CLIP-seq
MIRT1387673	hsa-miR-4747-5p	CLIP-seq
MIRT2338553	hsa-miR-4789-3p	CLIP-seq
MIRT1387694	hsa-miR-761	CLIP-seq
MIRT2395146	hsa-miR-10a	CLIP-seq
MIRT2395147	hsa-miR-10b	CLIP-seq
MIRT1387610	hsa-miR-2355-5p	CLIP-seq
MIRT1387614	hsa-miR-3918	CLIP-seq
MIRT2395148	hsa-miR-4267	CLIP-seq
MIRT1387619	hsa-miR-4512	CLIP-seq
MIRT2395149	hsa-miR-4690-3p	CLIP-seq
MIRT2632121	hsa-miR-1236	CLIP-seq
MIRT1387608	hsa-miR-1976	CLIP-seq
MIRT2632122	hsa-miR-3180-5p	CLIP-seq
MIRT2632123	hsa-miR-4279	CLIP-seq
MIRT2632124	hsa-miR-4326	CLIP-seq
MIRT2632125	hsa-miR-520a-5p	CLIP-seq
MIRT2632126	hsa-miR-525-5p	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
SP1	Unknown	19112177
TAF1	Unknown	14993269

Show/Hide all(186)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001545	Process	Primary ovarian follicle growth	IEA
GO:0002102	Component	Podosome	IEA
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0004672	Function	Protein kinase activity	IDA	18616680
GO:0004672	Function	Protein kinase activity	TAS
GO:0004713	Function	Protein tyrosine kinase activity	EXP	1381360, 9799234, 11448999, 12923167, 15735019, 18697750, 20100835
GO:0004713	Function	Protein tyrosine kinase activity	IBA	21873635
GO:0004713	Function	Protein tyrosine kinase activity	IDA	16441665, 19059439, 19307596
GO:0004713	Function	Protein tyrosine kinase activity	IMP	20624904, 25425738
GO:0004713	Function	Protein tyrosine kinase activity	NAS	28386764
GO:0004713	Function	Protein tyrosine kinase activity	TAS
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA	21873635
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	NAS	20018849
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	TAS	19267251
GO:0005080	Function	Protein kinase C binding	IEA
GO:0005102	Function	Signaling receptor binding	IBA	21873635
GO:0005102	Function	Signaling receptor binding	IPI	19332538
GO:0005158	Function	Insulin receptor binding	IEA
GO:0005178	Function	Integrin binding	IPI	19141530
GO:0005178	Function	Integrin binding	TAS	19267251
GO:0005515	Function	Protein binding	IPI	7478590, 7537265, 8070403, 8681387, 8849729, 9148935, 9162084, 9600099, 9763511, 10521452, 10542110, 10698938, 10801826, 11007774, 11149930, 11741929, 11923305, 11940572, 12509223, 12857726, 14963108, 15143158, 15546919, 15735685, 15749833, 15866871, 16115959, 16169070, 16273093, 162
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	16441665
GO:0005739	Component	Mitochondrion	IDA	19767770
GO:0005743	Component	Mitochondrial inner membrane	IDA	12615910
GO:0005764	Component	Lysosome	IDA	20605918
GO:0005770	Component	Late endosome	IDA	20605918
GO:0005829	Component	Cytosol	IDA	19767770
GO:0005829	Component	Cytosol	TAS
GO:0005884	Component	Actin filament	IEA
GO:0005886	Component	Plasma membrane	IDA	20605918
GO:0005886	Component	Plasma membrane	TAS
GO:0005901	Component	Caveola	IDA	17848177
GO:0005925	Component	Focal adhesion	ISS
GO:0007049	Process	Cell cycle	IEA
GO:0007155	Process	Cell adhesion	IBA	21873635
GO:0007165	Process	Signal transduction	TAS	9020193, 10734107
GO:0007169	Process	Transmembrane receptor protein tyrosine kinase signaling pathway	IBA	21873635
GO:0007172	Process	Signal complex assembly	TAS	9924018
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IBA	21873635
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	TAS
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IMP	24036928
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	24036928
GO:0007411	Process	Axon guidance	TAS
GO:0008022	Function	Protein C-terminus binding	IPI	25425738
GO:0008283	Process	Cell population proliferation	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0009615	Process	Response to virus	IEA
GO:0010447	Process	Response to acidic pH	IEA
GO:0010632	Process	Regulation of epithelial cell migration	IMP	21724833
GO:0010634	Process	Positive regulation of epithelial cell migration	IMP	18054784
GO:0010907	Process	Positive regulation of glucose metabolic process	IEA
GO:0010954	Process	Positive regulation of protein processing	IEA
GO:0014068	Process	Positive regulation of phosphatidylinositol 3-kinase signaling	TAS
GO:0014069	Component	Postsynaptic density	IEA
GO:0014911	Process	Positive regulation of smooth muscle cell migration	IEA
GO:0016032	Process	Viral process	IEA
GO:0016236	Process	Macroautophagy	TAS
GO:0016301	Function	Kinase activity	TAS
GO:0018105	Process	Peptidyl-serine phosphorylation	IEA
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IDA	12051764, 22732588
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IMP	20624904, 25425738
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	NAS	20018849
GO:0019899	Function	Enzyme binding	IPI	21724833
GO:0019900	Function	Kinase binding	IPI	19059439
GO:0020037	Function	Heme binding	IDA	21036157
GO:0022407	Process	Regulation of cell-cell adhesion	IMP	21724833
GO:0030054	Component	Cell junction	IDA
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0030168	Process	Platelet activation	TAS
GO:0030331	Function	Estrogen receptor binding	IEA
GO:0030900	Process	Forebrain development	IEA
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IBA	21873635
GO:0031295	Process	T cell costimulation	TAS
GO:0031333	Process	Negative regulation of protein-containing complex assembly	IMP	19767770
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0031648	Process	Protein destabilization	IEA
GO:0031667	Process	Response to nutrient levels	IEA
GO:0031954	Process	Positive regulation of protein autophosphorylation	IEA
GO:0032148	Process	Activation of protein kinase B activity	IEA
GO:0032211	Process	Negative regulation of telomere maintenance via telomerase	IMP	21531765
GO:0032587	Component	Ruffle membrane	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0033146	Process	Regulation of intracellular estrogen receptor signaling pathway	IEA
GO:0033625	Process	Positive regulation of integrin activation	TAS	19267251
GO:0034332	Process	Adherens junction organization	IEA
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IEA
GO:0035306	Process	Positive regulation of dephosphorylation	IDA	23159740
GO:0035556	Process	Intracellular signal transduction	IDA	15248232
GO:0035635	Process	Entry of bacterium into host cell	TAS
GO:0036035	Process	Osteoclast development	IBA	21873635
GO:0036120	Process	Cellular response to platelet-derived growth factor stimulus	IEA
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0038128	Process	ERBB2 signaling pathway	TAS
GO:0042169	Function	SH2 domain binding	IPI	8070403
GO:0042476	Process	Odontogenesis	IEA
GO:0042493	Process	Response to drug	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	19767770
GO:0043114	Process	Regulation of vascular permeability	TAS	19267251
GO:0043149	Process	Stress fiber assembly	IMP	24036928
GO:0043154	Process	Negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	19767770
GO:0043393	Process	Regulation of protein binding	IEA
GO:0043406	Process	Positive regulation of MAP kinase activity	IEA
GO:0043552	Process	Positive regulation of phosphatidylinositol 3-kinase activity	IEA
GO:0044325	Function	Ion channel binding	IPI	8953041, 12538589
GO:0045056	Process	Transcytosis	IEA
GO:0045087	Process	Innate immune response	IBA	21873635
GO:0045121	Component	Membrane raft	ISS
GO:0045124	Process	Regulation of bone resorption	TAS	19267251
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045453	Process	Bone resorption	IBA	21873635
GO:0045453	Process	Bone resorption	ISS
GO:0045737	Process	Positive regulation of cyclin-dependent protein serine/threonine kinase activity	IEA
GO:0045747	Process	Positive regulation of Notch signaling pathway	IDA	25731159
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IEA
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IEA
GO:0046628	Process	Positive regulation of insulin receptor signaling pathway	IEA
GO:0046777	Process	Protein autophosphorylation	IDA	16441665
GO:0046875	Function	Ephrin receptor binding	IPI	12925710
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	TAS
GO:0048011	Process	Neurotrophin TRK receptor signaling pathway	IEA
GO:0048013	Process	Ephrin receptor signaling pathway	TAS
GO:0048041	Process	Focal adhesion assembly	IMP	21411625
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	19307596
GO:0048477	Process	Oogenesis	IEA
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IC	18054784
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IMP	26598555, 26706435
GO:0050847	Process	Progesterone receptor signaling pathway	IBA	21873635
GO:0050847	Process	Progesterone receptor signaling pathway	ISS
GO:0050900	Process	Leukocyte migration	TAS
GO:0051057	Process	Positive regulation of small GTPase mediated signal transduction	IMP	18541665
GO:0051117	Function	ATPase binding	ISS
GO:0051219	Function	Phosphoprotein binding	IPI	16441665
GO:0051222	Process	Positive regulation of protein transport	IEA
GO:0051385	Process	Response to mineralocorticoid	IEA
GO:0051602	Process	Response to electrical stimulus	IEA
GO:0051895	Process	Negative regulation of focal adhesion assembly	ISS
GO:0051897	Process	Positive regulation of protein kinase B signaling	IMP	19767770
GO:0051897	Process	Positive regulation of protein kinase B signaling	TAS
GO:0051902	Process	Negative regulation of mitochondrial depolarization	IMP	19767770
GO:0051974	Process	Negative regulation of telomerase activity	IMP	21531765
GO:0060065	Process	Uterus development	IEA
GO:0060444	Process	Branching involved in mammary gland duct morphogenesis	IEA
GO:0060491	Process	Regulation of cell projection assembly	IEA
GO:0060576	Process	Intestinal epithelial cell development	IDA	25731159
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IDA	25731159
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070555	Process	Response to interleukin-1	IMP	19281832
GO:0070700	Function	BMP receptor binding	IPI	26598555
GO:0070851	Function	Growth factor receptor binding	IBA	21873635
GO:0070851	Function	Growth factor receptor binding	IPI	16479011
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071253	Function	Connexin binding	IEA
GO:0071375	Process	Cellular response to peptide hormone stimulus	ISS
GO:0071393	Process	Cellular response to progesterone stimulus	ISS
GO:0071398	Process	Cellular response to fatty acid	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071498	Process	Cellular response to fluid shear stress	IEA
GO:0071803	Process	Positive regulation of podosome assembly	IEA
GO:0071902	Process	Positive regulation of protein serine/threonine kinase activity	IDA	19059439
GO:0086098	Process	Angiotensin-activated signaling pathway involved in heart process	ISS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IEA
GO:0097110	Function	Scaffold protein binding	IPI	25006397
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098962	Process	Regulation of postsynaptic neurotransmitter receptor activity	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099091	Component	Postsynaptic specialization, intracellular component	IEA
GO:1900182	Process	Positive regulation of protein localization to nucleus	IEA
GO:1903997	Process	Positive regulation of non-membrane spanning protein tyrosine kinase activity	NAS	20018849
GO:2000386	Process	Positive regulation of ovarian follicle development	IEA
GO:2000394	Process	Positive regulation of lamellipodium morphogenesis	IMP	18054784
GO:2000573	Process	Positive regulation of DNA biosynthetic process	IEA
GO:2000588	Process	Positive regulation of platelet-derived growth factor receptor-beta signaling pathway	IEA
GO:2000641	Process	Regulation of early endosome to late endosome transport	IMP	21724833
GO:2000811	Process	Negative regulation of anoikis	IMP	22402981
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IBA	21873635
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IMP	19767770
GO:2001243	Process	Negative regulation of intrinsic apoptotic signaling pathway	IBA	21873635
GO:2001243	Process	Negative regulation of intrinsic apoptotic signaling pathway	IMP	19767770
GO:2001286	Process	Regulation of caveolin-mediated endocytosis	IMP	21724833

MIM	HGNC	e!Ensembl
190090	11283	ENSG00000197122

Protein

UniProt ID

P12931

Protein name

Proto-oncogene tyrosine-protein kinase Src (EC 2.7.10.2) (Proto-oncogene c-Src) (pp60c-src) (p60-Src)

Protein function

Non-receptor protein tyrosine kinase which is activated following engagement of many different classes of cellular receptors including immune response receptors, integrins and other adhesion receptors, receptor protein tyrosine kinases, G protei

PDB

1A07 , 1A08 , 1A09 , 1A1A , 1A1B , 1A1C , 1A1E , 1FMK , 1HCS , 1HCT , 1KSW , 1O41 , 1O42 , 1O43 , 1O44 , 1O45 , 1O46 , 1O47 , 1O48 , 1O49 , 1O4A , 1O4B , 1O4C , 1O4D , 1O4E , 1O4F , 1O4G , 1O4H , 1O4I , 1O4J , 1O4K , 1O4L , 1O4M , 1O4N , 1O4O , 1O4P , 1O4Q , 1O4R , 1SHD , 1Y57 , 1YI6 , 1YOJ , 1YOL , 1YOM , 2BDF , 2BDJ , 2H8H , 2SRC , 3VRO , 3ZMP , 3ZMQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00018	SH3_1	90 → 137	SH3 domain	Domain
PF00017	SH2	151 → 233	SH2 domain	Domain
PF07714	PK_Tyr_Ser-Thr	270 → 519	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed ubiquitously. Expressed in the skin (at protein level) (PubMed:22294297). Platelets, neurons and osteoclasts express 5-fold to 200-fold higher levels than most other tissues. {ECO:0000269|PubMed:22294297}.; TISSUE SPECIFICITY

Sequence

MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL

Sequence length

536

Interactions

View interactions

	KEGG		Reactome
	EGFR tyrosine kinase inhibitor resistance Endocrine resistance ErbB signaling pathway Rap1 signaling pathway Chemokine signaling pathway Hormone signaling Mitophagy - animal Endocytosis Axon guidance VEGF signaling pathway Focal adhesion Adherens junction Tight junction Gap junction Platelet activation Neutrophil extracellular trap formation C-type lectin receptor signaling pathway GABAergic synapse Inflammatory mediator regulation of TRP channels Regulation of actin cytoskeleton GnRH signaling pathway Estrogen signaling pathway Prolactin signaling pathway Thyroid hormone signaling pathway Oxytocin signaling pathway Relaxin signaling pathway Bacterial invasion of epithelial cells Epithelial cell signaling in Helicobacter pylori infection Pathogenic Escherichia coli infection Shigellosis Yersinia infection Tuberculosis Hepatitis B Human cytomegalovirus infection Kaposi sarcoma-associated herpesvirus infection Herpes simplex virus 1 infection Viral carcinogenesis Proteoglycans in cancer Chemical carcinogenesis - receptor activation Chemical carcinogenesis - reactive oxygen species Bladder cancer Lipid and atherosclerosis Fluid shear stress and atherosclerosis		Signaling by ERBB2 Nuclear signaling by ERBB4 Downregulation of ERBB4 signaling PIP3 activates AKT signaling Spry regulation of FGF signaling Signaling by SCF-KIT Regulation of KIT signaling Signaling by EGFR GAB1 signalosome Downstream signal transduction Regulation of gap junction activity FCGR activation PECAM1 interactions Constitutive Signaling by Aberrant PI3K in Cancer Integrin signaling GRB2:SOS provides linkage to MAPK signaling for Integrins p130Cas linkage to MAPK signaling for integrins CD28 co-stimulation CTLA4 inhibitory signaling EPHB-mediated forward signaling EPHA-mediated growth cone collapse Ephrin signaling EPH-ephrin mediated repulsion of cells G alpha (s) signalling events ADP signalling through P2Y purinoceptor 1 G alpha (i) signalling events DCC mediated attractive signaling GP1b-IX-V activation signalling Recycling pathway of L1 VEGFA-VEGFR2 Pathway Thrombin signalling through proteinase activated receptors (PARs) VEGFR2 mediated cell proliferation CLEC7A (Dectin-1) signaling RHO GTPases Activate Formins RAF activation MAP2K and MAPK activation Signaling by moderate kinase activity BRAF mutants Signaling by high-kinase activity BRAF mutants Signaling by BRAF and RAF fusions Paradoxical activation of RAF signaling by kinase inactive BRAF PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling Cyclin D associated events in G1 RET signaling MET activates PTK2 signaling InlA-mediated entry of Listeria monocytogenes into host cells Receptor Mediated Mitophagy Regulation of RUNX3 expression and activity Extra-nuclear estrogen signaling Activated NTRK3 signals through PI3K Signaling downstream of RAS mutants FCGR3A-mediated IL10 synthesis FCGR3A-mediated phagocytosis

Show/Hide Causal Diseases (14)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)	21357651
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	21357651
Carcinoma	Squamous cell carcinoma	rs121912654, rs555607708, rs786202962, rs1564055259	26908436
Colon cancer	COLON CANCER, ADVANCED, SOMATIC	rs63750781, rs63750691, rs63751657, rs63750547, rs1114167806, rs587780751, rs587781864, rs1114167435, rs1553641362, rs1434898623, rs587779018, rs1554298756, rs1573574436
Colonic neoplasms	Malignant tumor of colon, Colonic Neoplasms	rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483	14569062
Colorectal cancer	Colorectal Carcinoma	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800 View all (467 more)
Colorectal neoplasms	Colorectal Neoplasms	rs28929483, rs63751108, rs28929484, rs63749831, rs63750047, rs63751207, rs63749811, rs1553350126, rs63750875, rs63750955, rs587776706, rs63750871, rs587776715, rs63751466, rs63750049 View all (1682 more)
Hereditary nonpolyposis colorectal cancer	Hereditary nonpolyposis colorectal carcinoma	rs267607957, rs886044911, rs1064793185, rs144567652
Marfan syndrome	Mammary Carcinoma, Human	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465 View all (942 more)	21357651
Platelet-type bleeding disorder	Blood Platelet Disorders	rs1560045738, rs70961716, rs142186404, rs121918035, rs121918444, rs760074158, rs2146873791, rs387907345, rs387907346, rs387907348, rs387907350, rs397989794, rs587777211, rs587777529, rs724159972 View all (26 more)	26936507
Polycystic kidney disease	Autosomal Recessive Polycystic Kidney Disease	rs119103233, rs886041027, rs886041028, rs137852944, rs28937907, rs137852947, rs137852948, rs137852949, rs137852950, rs267607048, rs2147483647, rs199476094, rs1567154953, rs199476095, rs199476096 View all (740 more)	18385429
Myelofibrosis	Primary Myelofibrosis	rs77375493, rs587776885, rs1555760738, rs146249964, rs755257605
Renal carcinoma	Renal Cell Carcinoma	rs121913668, rs121913670, rs121913243, rs786202724
Thrombocytopenia	THROMBOCYTOPENIA 6	rs121908064, rs104894816, rs132630269, rs132630270, rs132630273, rs5030764, rs80338831, rs28928907, rs121909752, rs121918552, rs863223318, rs267607337, rs587778516, rs146249964, rs587776456 View all (48 more)	26936507

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Evidence	Source
Unknown
Colorectal Cancer	colorectal cancer	In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1.	GenCC, CBGDA
Rheumatoid arthritis	Rheumatoid arthritis		GWAS

Show/Hide Text Mining Associations (213)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	25007143, 25350844, 37010714
Adenocarcinoma of Lung	Associate	21623279, 22157722, 23874428, 26556867, 28415726, 29927028, 33593309, 33985619, 37000102
Adenoma	Associate	23778325
Adenoma	Stimulate	7509341
Adenomatous Polyposis Coli	Associate	27698945
Alzheimer Disease	Associate	26519433, 32812532, 34686734, 37010714
Amyotrophic Lateral Sclerosis	Associate	28539470, 37682161
Anophthalmia with pulmonary hypoplasia	Associate	22761868
Arterial Tortuosity Syndrome	Associate	26376865
Arthritis	Associate	18062965, 24385683
Arthritis Rheumatoid	Associate	12105209, 17963503, 23918525
Astrocytoma	Associate	22142990, 37402091
Ataxia Telangiectasia	Associate	11315256
Autistic Disorder	Associate	21703394
Barrett Esophagus	Associate	1398227, 23142123
Bernard Soulier Syndrome	Associate	40045897
Blood Platelet Disorders	Associate	20563533, 29297721, 31204551
Bone Diseases	Associate	20565769, 21741415, 31204551
Bone Neoplasms	Associate	25725252
Bone Resorption	Stimulate	38402724
Brain Neoplasms	Associate	36460775
Breast Carcinoma In Situ	Stimulate	19583841
Breast Neoplasms	Associate	11007774, 11315256, 11859072, 11875716, 12122014, 14629195, 14704150, 15031291, 15452162, 15743500, 16267617, 17060931, 17074804, 17121430, 17142325 View all (82 more)
Breast Neoplasms	Stimulate	17254967, 19583841
Burkitt Lymphoma	Associate	32171300
Calcinosis Cutis	Associate	23145001, 27028864
Calcinosis Cutis	Stimulate	38305916
Carcinogenesis	Associate	19948031, 20028973, 20080707, 21050441, 21822308, 22383989, 23585863, 24196445, 25149476, 30092789, 33771982, 37257767
Carcinogenesis	Stimulate	25679223, 29453318
Carcinoma	Associate	19318475, 25028927, 25779657
Carcinoma Basal Cell	Associate	27197167
Carcinoma Hepatocellular	Associate	15777850, 16891307, 20028973, 21725161, 25428919, 25943101, 25958313, 25978354, 27999817, 31732298, 32335258, 33794926, 34335982, 35452485, 38179744, 39406114, 40612868 View all (2 more)
Carcinoma Hepatocellular	Stimulate	40650282
Carcinoma Intraductal Noninfiltrating	Associate	17060931
Carcinoma Lobular	Stimulate	19583841
Carcinoma Non Small Cell Lung	Stimulate	16862215, 19861409, 26061184, 35877239, 37933017
Carcinoma Non Small Cell Lung	Associate	17200208, 19491201, 19804422, 19948031, 21423210, 23244248, 23686837, 24662916, 25163517, 25947404, 25955608, 27756880, 28415726, 29132432, 29848294 View all (7 more)
Carcinoma Pancreatic Ductal	Associate	20682659, 21841817, 22261810
Carcinoma Papillary	Stimulate	20405349
Carcinoma Renal Cell	Associate	21632985, 25187556, 26406598, 26911335, 29984342, 31181623, 31217736
Carcinoma Signet Ring Cell	Associate	25007143
Carcinoma Squamous Cell	Associate	18327819, 23696930, 26908436, 27323814
Carcinoma Transitional Cell	Associate	22353809
Cardiovascular Diseases	Associate	23778325
Cartilage Diseases	Associate	24385683
Cell Transformation Neoplastic	Associate	18326486, 25301365
Cerebral Infarction	Associate	37268894
Cholangiocarcinoma	Associate	34971568, 36154723
Chondrosarcoma	Associate	23922104, 23959473, 24992595, 25390068
Choriocarcinoma	Associate	23671128
Chromosome Aberrations	Associate	2506951
Cognition Disorders	Associate	32812532
Colitis Ulcerative	Associate	37078344, 37960728, 7509341
Colitis Ulcerative	Stimulate	7509341
Colonic Neoplasms	Associate	11900220, 25301365, 29135089, 7739521
Colonic Neoplasms	Stimulate	7509341
Colorectal Neoplasms	Associate	10373450, 10804287, 11161376, 11900220, 12402152, 15075377, 15326164, 15818752, 16432186, 16619028, 17572360, 17898132, 18035832, 18086662, 18183590 View all (44 more)
Colorectal Neoplasms	Stimulate	11163360, 7509341
Colorectal Neoplasms	Inhibit	27562229
Coronary Artery Disease	Inhibit	31222168
COVID 19	Associate	33796097
Craniopharyngioma	Associate	25990246
Cystic Fibrosis	Associate	11872746, 12506110, 14681029
Cysts	Associate	33112055
Deafness Autosomal Recessive 53	Associate	33925065
Death	Associate	19010820
Dermatitis Atopic	Associate	29498756
Diabetes Mellitus	Associate	25302671
Diabetic Foot	Associate	37985432
DNA Virus Infections	Associate	19861409
Drug Related Side Effects and Adverse Reactions	Associate	19652456, 19861409, 22505597, 22673740, 24407585, 26875492, 28606127, 34031486
Endocrine System Diseases	Associate	15452162, 19018258, 19830888, 32084531
Endocrine System Diseases	Stimulate	36266450, 37906431
Endometrial Neoplasms	Associate	10804287, 21058027, 37257767
Epilepsy	Inhibit	28273943
Epilepsy	Associate	35349645
Esophageal Neoplasms	Associate	25684946, 29034995
Esophageal Squamous Cell Carcinoma	Associate	29867084, 31815134
Fibrosarcoma	Associate	27323814
Fibrosis	Associate	25477471, 30471152, 34827680
Genital Neoplasms Female	Associate	10804287
Glioblastoma	Associate	15618223, 22323579, 26857460, 33841333, 34232320, 36460775, 38376284
Glioma	Associate	17572360, 17855624, 21878501, 22313687, 24879377, 28422726, 33833498, 34681583, 35862252, 39780215
Gliosarcoma	Associate	38097740
Glucosephosphate Dehydrogenase Deficiency	Associate	29963728
Growth Factors Combined Defect of	Associate	19491201
Hamartoma Syndrome Multiple	Associate	25149476
Head and Neck Neoplasms	Associate	23213056
Head and Neck Neoplasms	Stimulate	25779657
Heart Defects Congenital	Associate	26339408
Heart Diseases	Associate	37268894
Hemorrhage	Associate	31204551
HIV Infections	Associate	17920628
Hypoxia	Stimulate	20532039, 21408136, 27566104, 35338412
Hypoxia	Associate	23122428
Hypoxia Brain	Associate	36077517
Ichthyosis X Linked	Stimulate	37237151
Immune System Diseases	Associate	37070487
Infections	Associate	20674951, 34205064
Infections	Stimulate	24550731
Inflammation	Associate	12506110, 14681029, 20943963, 25302671, 26173590, 27742576, 28819180, 29498756, 29693170, 36460775, 36759733, 38087324
Inflammation	Stimulate	24499937
Inflammatory Bowel Diseases	Associate	35452485
Insulin Resistance	Associate	32651353
Intrahepatic Cholestasis of Pregnancy	Associate	35643225
Jaw Edentulous	Associate	31204551
Job Syndrome	Associate	23659370
Kidney Neoplasms	Associate	21330408, 39780215
Language Disorders	Associate	35349645
Leiomyosarcoma	Associate	25028927
Leukemia	Associate	15781338, 21447799, 2506951
Leukemia Lymphocytic Chronic B Cell	Associate	21135257, 32724091
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	19047139, 21760961
Leukemia Myeloid	Associate	2413444
Leukemia Myeloid Acute	Associate	24412064, 24858343, 31411110, 37070487
Liposarcoma Myxoid	Associate	20863376, 29190494
Livedoid Vasculopathy	Associate	32848033
Liver Failure	Associate	30471152
Lung Diseases	Associate	28454121
Lung Neoplasms	Associate	19491201, 20353998, 22178655, 23122428, 23319332, 23866081, 25140799, 25820822, 28068967, 28454121, 29132432, 29459573, 30925742, 34205482, 34427969, 35643725 View all (1 more)
Lupus Nephritis	Associate	36335193
Lymphatic Metastasis	Associate	18327819, 27999817, 28454121
Lymphatic Metastasis	Stimulate	29135089
Lymphoma B Cell Marginal Zone	Associate	27382024
Lymphoma Large Cell Anaplastic	Associate	17483340
Lymphoma Mantle Cell	Associate	32591642
Medulloblastoma	Associate	23497290, 36849558
Melanoma	Associate	12592021, 16371504, 16741510, 16798740, 18596671, 20796316, 21863025, 22127285, 22241959, 22310287, 22568947, 26740622, 31101498, 31416844, 33405952, 35208960, 36305167, 37963252 View all (3 more)
Melanoma	Stimulate	21654685
Mesothelioma Malignant	Associate	18096084, 27391433
Mouth Neoplasms	Associate	21291860, 26919242, 32183030, 34318593, 38250159
Multiple Myeloma	Associate	26421357
Multiple Sclerosis	Associate	23469041
Nasopharyngeal Carcinoma	Associate	29393436
Necrosis	Stimulate	17060931
Necrosis	Inhibit	32502618
Neoplasm Invasiveness	Associate	18594017, 26549256, 32680567
Neoplasm Metastasis	Associate	16432186, 17060931, 18383865, 19116446, 19321744, 19573804, 19573813, 19808905, 20010872, 20028973, 20228839, 20405349, 21480388, 21710320, 21725358 View all (33 more)
Neoplasm Metastasis	Inhibit	25860930, 29135089
Neoplasm Metastasis	Stimulate	38305916
Neoplasms	Stimulate	11007774, 11163360, 20028973, 20796316, 21725358, 26478515, 26549256, 27899592, 31521948, 36184518, 7509341
Neoplasms	Associate	11315256, 11875716, 11900220, 12518222, 12595559, 15031291, 15292208, 16267617, 16685275, 16951177, 17060931, 1716952, 17254967, 17449913, 18086662 View all (125 more)
Neoplasms	Inhibit	23533633, 25534237, 28427224, 8241509
Neoplasms Glandular and Epithelial	Associate	23949446
Neoplasms Neuroepithelial	Inhibit	25534237
Neoplasms Squamous Cell	Associate	23696930, 28656243, 29739791
Nephrotic Syndrome	Associate	34873575
Nerve Degeneration	Associate	28539470
Nervous System Diseases	Associate	25909165
Neural crest tumor	Associate	27438149
Neurilemmoma	Associate	22247700
Neuroblastoma	Associate	17828307, 19885861, 21050441, 2414774, 27821809, 2830484, 30020827, 31406249
Neuroendocrine Tumors	Associate	23676460
Neurofibromatosis 2	Inhibit	28427224
Neurologic Manifestations	Associate	35349645
Norrie disease	Associate	17963503
Obesity	Stimulate	30658193
Oncogene Addiction	Associate	24499937
Osteoarthritis	Associate	17963503
Osteoporosis	Associate	36937804
Osteosarcoma	Associate	25725252, 30092789, 32847038
Ovarian Diseases	Associate	38097740
Ovarian Neoplasms	Associate	14676209, 16951177, 18632638, 19116446, 20371672, 21208651, 21785464, 24407585, 27166196, 28179359, 28446239, 28859612, 29324748, 31233194, 33921111, 34207568, 35370009 View all (2 more)
Pancreatic Neoplasms	Stimulate	15292208
Pancreatic Neoplasms	Associate	20682659, 21573184, 22761868, 23206899, 23342270, 23920124, 25170871, 25215932, 25268648, 29978609, 32422890, 32438692, 33213062, 34192548, 36184518, 36434556, 37542052 View all (2 more)
Parkinson Disease	Associate	19139008
Pemphigus	Associate	24328683
Pharyngeal Neoplasms	Associate	26001294
Polycystic Kidney Autosomal Recessive	Associate	33112055
Polycystic Kidney Diseases	Associate	21697238
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	22895079, 32898857
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	23872305
Primary Myelofibrosis	Associate	31204551
Prostatic Neoplasms	Associate	18350153, 18383865, 18623111, 18679417, 18687691, 19706771, 20412587, 22378065, 22390300, 22860065, 23145001, 23192379, 23559371, 23698767, 24174371 View all (17 more)
Prostatic Neoplasms Castration Resistant	Associate	24788563
Prostatitis	Associate	18350153, 24174371, 24817628
Pulmonary Arterial Hypertension	Associate	16002577
Purpura Thrombocytopenic Idiopathic	Associate	35349645
Radiation Injuries	Associate	36530656
Retinoblastoma	Associate	10544291
Salivary Gland Neoplasms	Associate	31115008
Sarcoma	Associate	22461510, 30745580
Sarcoma Ewing	Associate	27566104, 31521948
Sarcoma Kaposi	Associate	10640727, 28957431
Schwartz Lelek syndrome	Associate	7678608
Seminoma	Associate	30646583
Simpson Golabi Behmel syndrome	Associate	31204551
Skin Neoplasms	Stimulate	20796316
Skin Neoplasms	Associate	37635193
Small Cell Lung Carcinoma	Associate	2830484, 36931608, 38237798
Squamous Cell Carcinoma of Head and Neck	Associate	12771142, 18327819, 18594011, 18594017, 23047035, 23146907, 23213056, 24192080, 24565984, 25405202, 25779657, 29739791, 29970910, 31115008, 31118072 View all (6 more)
Stomach Diseases	Associate	22442341
Stomach Neoplasms	Associate	20100835, 21698158, 22039045, 22383989, 23790975, 24260584, 24841138, 25337202, 25350844, 25432133, 25590580, 26460485, 26945908, 27077843, 29749547 View all (6 more)
T cell immunodeficiency primary	Associate	37070487
Tarlov Cysts	Associate	24768607
Testicular Germ Cell Tumor	Associate	30646583
Thrombocytopenia	Associate	31204551, 35349645
Thyroid Diseases	Associate	20405349
Thyroid Hormone Resistance Syndrome	Associate	9707435
Thyroid Neoplasms	Associate	22696507, 25149476, 30531837
Tongue Neoplasms	Associate	29970910
Triple Negative Breast Neoplasms	Associate	19018258, 21357651, 22457730, 22957061, 25068292, 25304315, 25980494, 27472710, 29288363, 31882647, 32358373, 32558176, 36633714, 37906431
Tuberculosis Multidrug Resistant	Associate	22957062
Urethral Neoplasms	Associate	36862682
Urinary Bladder Neoplasms	Associate	16103120, 19321744, 21836020, 22353809, 32802870, 33830879, 36530656, 37166992, 38200039
Uterine Cervical Neoplasms	Associate	23696930, 24058594, 32604782
Uterine Diseases	Associate	21058027
Uveal melanoma	Associate	26066330
Venous Malformations Multiple Cutaneous and Mucosal	Stimulate	28316284
Venous Malformations Multiple Cutaneous and Mucosal	Associate	28316284
Waldenstrom Macroglobulinemia	Associate	19755386
Wolf Hirschhorn Syndrome	Associate	2506951
X Linked Combined Immunodeficiency Diseases	Associate	35272617

SRC (SRC proto-oncogene, non-receptor tyrosine kinase)