SPRR2E (small proline rich protein 2E)

Gene

• Entrez ID: 6704
• Gene name: Small proline rich protein 2E
• Gene symbol: SPRR2E
• Synonyms (NCBI Gene): -
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: This gene encodes a member of a family of small proline-rich proteins clustered in the epidermal differentiation complex on chromosome 1q21. The encoded protein, along with other family members, is a component of the cornified cell envelope that forms ben

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1385981	hsa-miR-125a-3p	CLIP-seq
MIRT1385982	hsa-miR-25	CLIP-seq
MIRT1385983	hsa-miR-3152-3p	CLIP-seq
MIRT1385984	hsa-miR-32	CLIP-seq
MIRT1385985	hsa-miR-3609	CLIP-seq
MIRT1385986	hsa-miR-363	CLIP-seq
MIRT1385987	hsa-miR-367	CLIP-seq
MIRT1385988	hsa-miR-3934	CLIP-seq
MIRT1385989	hsa-miR-4504	CLIP-seq
MIRT1385990	hsa-miR-4641	CLIP-seq
MIRT1385991	hsa-miR-4694-5p	CLIP-seq
MIRT1385992	hsa-miR-4726-3p	CLIP-seq
MIRT1385993	hsa-miR-548ah	CLIP-seq
MIRT1385994	hsa-miR-548t	CLIP-seq
MIRT1385995	hsa-miR-552	CLIP-seq
MIRT1385996	hsa-miR-92a	CLIP-seq
MIRT1385997	hsa-miR-92b	CLIP-seq
MIRT2631748	hsa-miR-183	CLIP-seq
MIRT2631749	hsa-miR-3688-5p	CLIP-seq
MIRT2631750	hsa-miR-885-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001533	Component	Cornified envelope	IDA	7543090, 9722562
GO:0001533	Component	Cornified envelope	TAS
GO:0005198	Function	Structural molecule activity	TAS	3133554
GO:0005515	Function	Protein binding	IPI	9722562
GO:0005737	Component	Cytoplasm	IDA	3133554
GO:0005829	Component	Cytosol	TAS
GO:0008544	Process	Epidermis development	NAS	8325635
GO:0018149	Process	Peptide cross-linking	IDA	7543090, 9722562
GO:0030280	Function	Structural constituent of skin epidermis	IDA	7543090, 9722562
GO:0070268	Process	Cornification	TAS

Other IDs

• MIM: 617588
• HGNC: 11265
• e!Ensembl: ENSG00000203785

Protein

• UniProt ID: P22531
• Protein name: Small proline-rich protein 2E (SPR-2E) (Small proline-rich protein II) (SPR-II)
• Protein function: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14820	SPRR2	2 → 69	Small proline-rich 2	Family

• Sequence:

  MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKCPPVTPS
  PPCQPKCPPKSK

• Sequence length: 72

Pathways

Reactome:

Formation of the cornified envelope

Associated diseases

Unknown
Disease term	Disease name	Evidence	References	Source
Eczema	Eczema			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Melanoma Cutaneous Malignant	Associate	33823876
Neoplasms	Associate	30008265
Squamous Cell Carcinoma of Head and Neck	Associate	33869632