SPRR2E (small proline rich protein 2E)

Gene

• Entrez ID: 6704
• Gene name: Small proline rich protein 2E
• Gene symbol: SPRR2E
• Synonyms (NCBI Gene): -
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: This gene encodes a member of a family of small proline-rich proteins clustered in the epidermal differentiation complex on chromosome 1q21. The encoded protein, along with other family members, is a component of the cornified cell envelope that forms ben

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1385981	hsa-miR-125a-3p	CLIP-seq
MIRT1385982	hsa-miR-25	CLIP-seq
MIRT1385983	hsa-miR-3152-3p	CLIP-seq
MIRT1385984	hsa-miR-32	CLIP-seq
MIRT1385985	hsa-miR-3609	CLIP-seq
MIRT1385986	hsa-miR-363	CLIP-seq
MIRT1385987	hsa-miR-367	CLIP-seq
MIRT1385988	hsa-miR-3934	CLIP-seq
MIRT1385989	hsa-miR-4504	CLIP-seq
MIRT1385990	hsa-miR-4641	CLIP-seq
MIRT1385991	hsa-miR-4694-5p	CLIP-seq
MIRT1385992	hsa-miR-4726-3p	CLIP-seq
MIRT1385993	hsa-miR-548ah	CLIP-seq
MIRT1385994	hsa-miR-548t	CLIP-seq
MIRT1385995	hsa-miR-552	CLIP-seq
MIRT1385996	hsa-miR-92a	CLIP-seq
MIRT1385997	hsa-miR-92b	CLIP-seq
MIRT2631748	hsa-miR-183	CLIP-seq
MIRT2631749	hsa-miR-3688-5p	CLIP-seq
MIRT2631750	hsa-miR-885-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001533	Component	Cornified envelope	IDA	7543090, 9722562
GO:0001533	Component	Cornified envelope	IEA
GO:0001533	Component	Cornified envelope	TAS
GO:0005198	Function	Structural molecule activity	TAS	3133554
GO:0005515	Function	Protein binding	IPI	9722562
GO:0005737	Component	Cytoplasm	IDA	3133554
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0008544	Process	Epidermis development	NAS	8325635
GO:0018149	Process	Peptide cross-linking	IDA	7543090, 9722562
GO:0030280	Function	Structural constituent of skin epidermis	IDA	7543090, 9722562
GO:0031424	Process	Keratinization	IEA

Other IDs

• MIM: 617588
• HGNC: 11265
• e!Ensembl: ENSG00000203785

Protein

• UniProt ID: P22531
• Protein name: Small proline-rich protein 2E (SPR-2E) (Small proline-rich protein II) (SPR-II)
• Protein function: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14820	SPRR2	2 → 69	Small proline-rich 2	Family

• Sequence:

  MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKCPPVTPS
  PPCQPKCPPKSK

• Sequence length: 72

Pathways

Reactome:

Formation of the cornified envelope