Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	6696
Gene name	Secreted phosphoprotein 1
Gene symbol	SPP1
Synonyms (NCBI Gene)	BNSPBSPIETA-1OPN
Chromosome	4
Chromosome location	4q22.1
Summary	The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. The encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane an

Show/Hide all (16)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004565	hsa-miR-299-5p	immunoblot	19538464
MIRT004565	hsa-miR-299-5p	qRT-PCR	19538464
MIRT004565	hsa-miR-299-5p	Luciferase reporter assay	19538464
MIRT004565	hsa-miR-299-5p	Luciferase reporter assay	19538464
MIRT004565	hsa-miR-299-5p	immunoblotLuciferase reporter assayMicroarrayqRT-PCR	19538464
MIRT016866	hsa-miR-335-5p	Microarray	18185580
MIRT021279	hsa-miR-146a-5p	qRT-PCR	20110513
MIRT732307	hsa-miR-181b-5p	Luciferase reporter assayqRT-PCRWestern blot	27192552
MIRT732307	hsa-miR-181b-5p	Luciferase reporter assayqRT-PCRWestern blot	27192552
MIRT021279	hsa-miR-146a-5p	qRT-PCR	32921164
MIRT755688	hsa-miR-26a-5p	Western blottingqRT-PCRFlow cytometry	35246197
MIRT2433518	hsa-miR-181a	CLIP-seq
MIRT2433519	hsa-miR-181b	CLIP-seq
MIRT2433520	hsa-miR-181c	CLIP-seq
MIRT2433521	hsa-miR-181d	CLIP-seq
MIRT2433522	hsa-miR-577	CLIP-seq

Show/Hide all (12)

Transcription factor	Regulation	Reference
CEBPA	Activation	14712233
ERG	Activation	21669963
FOXD3	Activation	11891324
HDAC1	Repression	20609221;22422937
HTATIP2	Repression	18537194;19349353
ING4	Repression	17848618
NR3C1	Unknown	11126367
POU2F1	Unknown	11126367
POU2F2	Unknown	11126367
POU5F1	Activation	11891324
SP1	Unknown	11126367
TFCP2	Activation	20404171;21703197

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001503	Process	Ossification	IEA
GO:0001649	Process	Osteoblast differentiation	IBA
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0005125	Function	Cytokine activity	IEA
GO:0005178	Function	Integrin binding	IPI	25839998
GO:0005515	Function	Protein binding	IPI	8560266, 10747989, 11162539, 16189514, 21988832, 22582013, 25416956, 25789606, 25910212, 26091039, 32296183, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	15516325
GO:0005615	Component	Extracellular space	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005794	Component	Golgi apparatus	IDA
GO:0006710	Process	Androgen catabolic process	IDA	26482249
GO:0007155	Process	Cell adhesion	IBA
GO:0007155	Process	Cell adhesion	IDA	25839998
GO:0007155	Process	Cell adhesion	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007566	Process	Embryo implantation	TAS	16720713
GO:0030154	Process	Cell differentiation	IEA
GO:0031214	Process	Biomineral tissue development	IEA
GO:0031982	Component	Vesicle	IEA
GO:0033280	Process	Response to vitamin D	IDA	16720713
GO:0036005	Process	Response to macrophage colony-stimulating factor	IEA
GO:0036094	Function	Small molecule binding	EXP	33914399
GO:0042995	Component	Cell projection	IEA
GO:0045780	Process	Positive regulation of bone resorption	IBA
GO:0045780	Process	Positive regulation of bone resorption	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	26482249
GO:0046697	Process	Decidualization	TAS	16720713
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048545	Process	Response to steroid hormone	IEA
GO:0048685	Process	Negative regulation of collateral sprouting of intact axon in response to injury	IEA
GO:0050840	Function	Extracellular matrix binding	IBA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071394	Process	Cellular response to testosterone stimulus	IDA	26482249
GO:1904612	Process	Response to 2,3,7,8-tetrachlorodibenzodioxine	IEA
GO:2000866	Process	Positive regulation of estradiol secretion	IDA	26482249

MIM	HGNC	e!Ensembl
166490	11255	ENSG00000118785

P10451

Protein name

Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)

Protein function

Major non-collagenous bone protein that binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction. ; Acts as a cytokine inv

PDB

3CXD , 3DSF , 9EOU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00865	Osteopontin	21 → 314	Osteopontin	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in cerebrospinal fluid and urine (at protein level) (PubMed:25326458, PubMed:36213313, PubMed:37453717). Bone. Found in plasma. {ECO:0000269|PubMed:25326458, ECO:0000269|PubMed:36213313, ECO:0000269|PubMed:37453717}.

Sequence

MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNA
VSSEETNDFKQETLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQS
DESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQ
YPDATDEDITSHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSH
KQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKF
RISHELDSASSEVN

Sequence length

314

Interactions

View interactions

	KEGG		Reactome
	PI3K-Akt signaling pathway Apelin signaling pathway Focal adhesion ECM-receptor interaction Toll-like receptor signaling pathway GnRH secretion Human papillomavirus infection		Degradation of the extracellular matrix Signaling by PDGF Integrin cell surface interactions Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) RUNX3 Regulates Immune Response and Cell Migration Post-translational protein phosphorylation

SPP1 (secreted phosphoprotein 1)