Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6695
Gene name Gene Name - the full gene name approved by the HGNC.
SPARC (osteonectin), cwcv and kazal like domains proteoglycan 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SPOCK1
Synonyms (NCBI Gene) Gene synonyms aliases
SPOCK, TESTICAN, TIC1
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q31.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes the protein core of a seminal plasma proteoglycan containing chondroitin- and heparan-sulfate chains. The protein`s function is unknown, although similarity to thyropin-type cysteine protease-inhibitors suggests its function may be relat
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT735322 hsa-miR-375 RNA-seq, qRT-PCR 32313120
MIRT734956 hsa-miR-130a-3p Western blotting, qRT-PCR 31526129
MIRT736080 hsa-miR-548c-3p Microarray 31498480
MIRT1385071 hsa-miR-1183 CLIP-seq
MIRT1385072 hsa-miR-1253 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001558 Process Regulation of cell growth NAS 8389704
GO:0001764 Process Neuron migration ISS
GO:0004867 Function Serine-type endopeptidase inhibitor activity NAS 14511383
GO:0004869 Function Cysteine-type endopeptidase inhibitor activity IDA 14511383
GO:0005201 Function Extracellular matrix structural constituent HDA 27068509
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602264 11251 ENSG00000152377
Protein
UniProt ID Q08629
Protein name Testican-1 (Protein SPOCK)
Protein function May play a role in cell-cell and cell-matrix interactions. May contribute to various neuronal mechanisms in the central nervous system.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07648 Kazal_2 134 180 Kazal-type serine protease inhibitor domain Domain
PF10591 SPARC_Ca_bdg 195 304 Secreted protein acidic and rich in cysteine Ca binding region Domain
PF00086 Thyroglobulin_1 313 376 Thyroglobulin type-1 repeat Domain
Sequence
MPAIAVLAAAAAAWCFLQVESRHLDALAGGAGPNHGNFLDNDQWLSTVSQYDRDKYWNRF
RDDDYFRNWNPNKPFDQALDPSKDPCLKVKCSPHKVCVTQDYQTALCVSRKHLLPRQKKG
NVAQKHWVGPSNLVKCKPCPVAQSAMVCGSDGHSYTSKCKLEFHACSTGKSLATLCDGPC
PCLPEPEPPKHKAERSACTDKELRNLASRLKDWFGALHEDANRVIKPTSSNTAQGRFDTS
ILPICKDSLGWMFNKLDMNYDLLLDPSEINAIYLDKYEPCIKPLFNSCDSFKDGKLSNNE
WCYC
FQKPGGLPCQNEMNRIQKLSKGKSLLGAFIPRCNEEGYYKATQCHGSTGQCWCVDK
YGNELAGSRKQGAVSC
EEEQETSGDFGSGGSVVLLDDLEYERELGPKDKEGKLRVHTRAV
TEDDEDEDDDKEDEVGYIW
Sequence length 439
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Bronchopulmonary Dysplasia Bronchopulmonary dysplasia N/A N/A GWAS
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 38087364
Adenoma Associate 37779184
Alzheimer Disease Stimulate 27486134
Aortic Aneurysm Abdominal Associate 25993293
Aortic Valve Stenosis Associate 37175670
Brain Injuries Traumatic Associate 36482407
Breast Neoplasms Associate 27626636
Carcinoma Ductal Associate 27626636
Carcinoma Hepatocellular Associate 33517826
Carcinoma Non Small Cell Lung Stimulate 29461591