Gene Gene information from NCBI Gene database.
Entrez ID 6695
Gene name SPARC (osteonectin), cwcv and kazal like domains proteoglycan 1
Gene symbol SPOCK1
Synonyms (NCBI Gene)
SPOCKTESTICANTIC1
Chromosome 5
Chromosome location 5q31.2
Summary This gene encodes the protein core of a seminal plasma proteoglycan containing chondroitin- and heparan-sulfate chains. The protein`s function is unknown, although similarity to thyropin-type cysteine protease-inhibitors suggests its function may be relat
miRNA miRNA information provided by mirtarbase database.
574
miRTarBase ID miRNA Experiments Reference
MIRT735322 hsa-miR-375 RNA-seqqRT-PCR 32313120
MIRT734956 hsa-miR-130a-3p Western blottingqRT-PCR 31526129
MIRT736080 hsa-miR-548c-3p Microarray 31498480
MIRT1385071 hsa-miR-1183 CLIP-seq
MIRT1385072 hsa-miR-1253 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
29
GO ID Ontology Definition Evidence Reference
GO:0001558 Process Regulation of cell growth NAS 8389704
GO:0001764 Process Neuron migration ISS
GO:0004867 Function Serine-type endopeptidase inhibitor activity NAS 14511383
GO:0004869 Function Cysteine-type endopeptidase inhibitor activity IDA 14511383
GO:0005201 Function Extracellular matrix structural constituent HDA 27068509
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602264 11251 ENSG00000152377
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q08629
Protein name Testican-1 (Protein SPOCK)
Protein function May play a role in cell-cell and cell-matrix interactions. May contribute to various neuronal mechanisms in the central nervous system.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07648 Kazal_2 134 180 Kazal-type serine protease inhibitor domain Domain
PF10591 SPARC_Ca_bdg 195 304 Secreted protein acidic and rich in cysteine Ca binding region Domain
PF00086 Thyroglobulin_1 313 376 Thyroglobulin type-1 repeat Domain
Sequence
MPAIAVLAAAAAAWCFLQVESRHLDALAGGAGPNHGNFLDNDQWLSTVSQYDRDKYWNRF
RDDDYFRNWNPNKPFDQALDPSKDPCLKVKCSPHKVCVTQDYQTALCVSRKHLLPRQKKG
NVAQKHWVGPSNLVKCKPCPVAQSAMVCGSDGHSYTSKCKLEFHACSTGKSLATLCDGPC
PCLPEPEPPKHKAERSACTDKELRNLASRLKDWFGALHEDANRVIKPTSSNTAQGRFDTS
ILPICKDSLGWMFNKLDMNYDLLLDPSEINAIYLDKYEPCIKPLFNSCDSFKDGKLSNNE
WCYC
FQKPGGLPCQNEMNRIQKLSKGKSLLGAFIPRCNEEGYYKATQCHGSTGQCWCVDK
YGNELAGSRKQGAVSC
EEEQETSGDFGSGGSVVLLDDLEYERELGPKDKEGKLRVHTRAV
TEDDEDEDDDKEDEVGYIW
Sequence length 439
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
4
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Microcephaly Uncertain significance rs151283855 RCV001252868
SPOCK1-related disorder Likely benign rs199506446, rs144155642, rs1220306555 RCV003934579
RCV003931624
RCV003971504
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 38087364
Adenoma Associate 37779184
Alzheimer Disease Stimulate 27486134
Aortic Aneurysm Abdominal Associate 25993293
Aortic Valve Stenosis Associate 37175670
Brain Injuries Traumatic Associate 36482407
Breast Neoplasms Associate 27626636
Carcinoma Ductal Associate 27626636
Carcinoma Hepatocellular Associate 33517826
Carcinoma Non Small Cell Lung Stimulate 29461591