Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6693
Gene name Gene Name - the full gene name approved by the HGNC.
Sialophorin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SPN
Synonyms (NCBI Gene) Gene synonyms aliases
CD43, GALGP, GPL115, LEU-22, LSN
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16p11.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a highly sialylated glycoprotein that functions in antigen-specific activation of T cells, and is found on the surface of thymocytes, T lymphocytes, monocytes, granulocytes, and some B lymphocytes. It contains a mucin-like extracellular
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT052328 hsa-let-7b-5p CLASH 23622248
MIRT051630 hsa-let-7e-5p CLASH 23622248
MIRT710297 hsa-miR-590-3p HITS-CLIP 19536157
MIRT710296 hsa-miR-6765-3p HITS-CLIP 19536157
MIRT710295 hsa-miR-1279 HITS-CLIP 19536157
Transcription factors
Transcription factor Regulation Reference
SP1 Activation 8055899
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001562 Process Response to protozoan IEA
GO:0001808 Process Negative regulation of type IV hypersensitivity IEA
GO:0001931 Component Uropod IEA
GO:0001931 Component Uropod ISS
GO:0002296 Process T-helper 1 cell lineage commitment IDA 18036228
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
182160 11249 ENSG00000197471
Protein
UniProt ID P16150
Protein name Leukosialin (GPL115) (Galactoglycoprotein) (GALGP) (Leukocyte sialoglycoprotein) (Sialophorin) (CD antigen CD43) [Cleaved into: CD43 cytoplasmic tail (CD43-ct) (CD43ct)]
Protein function Predominant cell surface sialoprotein of leukocytes which regulates multiple T-cell functions, including T-cell activation, proliferation, differentiation, trafficking and migration. Positively regulates T-cell trafficking to lymph-nodes via its
Family and domains
Tissue specificity TISSUE SPECIFICITY: Cell surface of thymocytes, T-lymphocytes, neutrophils, plasma cells and myelomas.
Sequence
MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGD
QTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPI
TANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSK
GTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNA
STVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVV
DAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEE
LKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP
Sequence length 400
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cell adhesion molecules   Cell surface interactions at the vascular wall
Basigin interactions
<