Gene Gene information from NCBI Gene database.
Entrez ID 669
Gene name Bisphosphoglycerate mutase
Gene symbol BPGM
Synonyms (NCBI Gene)
DPGMECYT8
Chromosome 7
Chromosome location 7q33
Summary 2,3-diphosphoglycerate (2,3-DPG) is a small molecule found at high concentrations in red blood cells where it binds to and decreases the oxygen affinity of hemoglobin. This gene encodes a multifunctional enzyme that catalyzes 2,3-DPG synthesis via its syn
SNPs SNP information provided by dbSNP.
2
SNP ID Visualize variation Clinical significance Consequence
rs121964925 C>T Pathogenic Missense variant, coding sequence variant
rs786205092 C>- Pathogenic Coding sequence variant, frameshift variant
miRNA miRNA information provided by mirtarbase database.
68
miRTarBase ID miRNA Experiments Reference
MIRT019319 hsa-miR-148b-3p Microarray 17612493
MIRT022045 hsa-miR-128-3p Microarray 17612493
MIRT023275 hsa-miR-122-5p Microarray 17612493
MIRT025166 hsa-miR-181a-5p Microarray 17612493
MIRT043853 hsa-miR-340-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
24
GO ID Ontology Definition Evidence Reference
GO:0003824 Function Catalytic activity IEA
GO:0004082 Function Bisphosphoglycerate mutase activity IBA
GO:0004082 Function Bisphosphoglycerate mutase activity IEA
GO:0004082 Function Bisphosphoglycerate mutase activity TAS 2542247
GO:0004619 Function Phosphoglycerate mutase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
613896 1093 ENSG00000172331
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P07738
Protein name Bisphosphoglycerate mutase (BPGM) (EC 5.4.2.4) (2,3-bisphosphoglycerate mutase, erythrocyte) (2,3-bisphosphoglycerate synthase) (EC 5.4.2.11) (2,3-diphosphoglycerate mutase) (DPGM) (BPG-dependent PGAM)
Protein function Plays a major role in regulating hemoglobin oxygen affinity by controlling the levels of its allosteric effector 2,3-bisphosphoglycerate (2,3-BPG). Also exhibits mutase (EC 5.4.2.11) activity.
PDB 1T8P , 2A9J , 2F90 , 2H4X , 2H4Z , 2H52 , 2HHJ , 3NFY , 7N3R , 7N3S , 7THI , 8X2S
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00300 His_Phos_1 6 137 Histidine phosphatase superfamily (branch 1) Domain
PF00300 His_Phos_1 127 229 Histidine phosphatase superfamily (branch 1) Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in red blood cells. Expressed in non-erythroid cells of the placenta; present in the syncytiotrophoblast layer of the placental villi at the feto-maternal interface (at protein level). {ECO:0000269|PubMed:16246416, ECO:000026
Sequence
MSKYKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVL
NRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYN
VTPPPI
EESHPYYQEIYNDRRYKVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRG
KTILISAHGNSSRALLKHLEGISDEDIINITLPTGVPILLELDENLRAV
GPHQFLGDQEA
IQAAIKKVEDQGKVKQAKK
Sequence length 259
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
  Glycolysis
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
7
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Deficiency of bisphosphoglycerate mutase Pathogenic rs121964925, rs786205092, rs751972865, rs781222092 RCV000012872
RCV000012873
RCV001249567
RCV001249568
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Glucosephosphate Dehydrogenase Deficiency Associate 15054810
Polycythemia Associate 15054810, 27651169