Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
669
Gene name Gene Name - the full gene name approved by the HGNC.
Bisphosphoglycerate mutase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BPGM
Synonyms (NCBI Gene) Gene synonyms aliases
DPGM, ECYT8
Disease Acronyms (UniProt) Disease acronyms from UniProt database
ECYT8
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q33
Summary Summary of gene provided in NCBI Entrez Gene.
2,3-diphosphoglycerate (2,3-DPG) is a small molecule found at high concentrations in red blood cells where it binds to and decreases the oxygen affinity of hemoglobin. This gene encodes a multifunctional enzyme that catalyzes 2,3-DPG synthesis via its syn
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121964925 C>T Pathogenic Missense variant, coding sequence variant
rs786205092 C>- Pathogenic Coding sequence variant, frameshift variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019319 hsa-miR-148b-3p Microarray 17612493
MIRT022045 hsa-miR-128-3p Microarray 17612493
MIRT023275 hsa-miR-122-5p Microarray 17612493
MIRT025166 hsa-miR-181a-5p Microarray 17612493
MIRT043853 hsa-miR-340-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004082 Function Bisphosphoglycerate mutase activity IEA
GO:0004619 Function Phosphoglycerate mutase activity IEA
GO:0005515 Function Protein binding IPI 28514442, 32296183
GO:0005829 Component Cytosol TAS
GO:0005975 Process Carbohydrate metabolic process NAS 2542247
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
613896 1093 ENSG00000172331
Protein
UniProt ID P07738
Protein name Bisphosphoglycerate mutase (BPGM) (EC 5.4.2.4) (2,3-bisphosphoglycerate mutase, erythrocyte) (2,3-bisphosphoglycerate synthase) (EC 5.4.2.11) (2,3-diphosphoglycerate mutase) (DPGM) (BPG-dependent PGAM)
Protein function Plays a major role in regulating hemoglobin oxygen affinity by controlling the levels of its allosteric effector 2,3-bisphosphoglycerate (2,3-BPG). Also exhibits mutase (EC 5.4.2.11) activity.
PDB 1T8P , 2A9J , 2F90 , 2H4X , 2H4Z , 2H52 , 2HHJ , 3NFY , 7N3R , 7N3S , 7THI , 8X2S
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00300 His_Phos_1 6 137 Histidine phosphatase superfamily (branch 1) Domain
PF00300 His_Phos_1 127 229 Histidine phosphatase superfamily (branch 1) Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in red blood cells. Expressed in non-erythroid cells of the placenta; present in the syncytiotrophoblast layer of the placental villi at the feto-maternal interface (at protein level). {ECO:0000269|PubMed:16246416, ECO:000026
Sequence
MSKYKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVL
NRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYN
VTPPPI
EESHPYYQEIYNDRRYKVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRG
KTILISAHGNSSRALLKHLEGISDEDIINITLPTGVPILLELDENLRAV
GPHQFLGDQEA
IQAAIKKVEDQGKVKQAKK
Sequence length 259
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
  Glycolysis
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Anemia Normocytic anemia rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966
View all (89 more)
Cholelithiasis Cholelithiasis rs121918440, rs72552778, rs387906528, rs759202962, rs377160065, rs1051861187, rs757693457, rs752563752
Deficiency of bisphosphoglycerate mutase Deficiency of bisphosphoglycerate mutase rs121964925, rs786205092 2542247, 1421379, 15054810
Hemolytic anemia Nonspherocytic hemolytic anemia, Hemolytic anemia due to diphosphoglycerate mutase deficiency rs104894025, rs104894026, rs397518435, rs397518436, rs104894027, rs397518437, rs104894028, rs397518438, rs104894029, rs137853583, rs137853585, rs137853586, rs137853587, rs267606851, rs267606852
View all (18 more)
Associations from Text Mining
Disease Name Relationship Type References
Glucosephosphate Dehydrogenase Deficiency Associate 15054810
Polycythemia Associate 15054810, 27651169