SPIB (Spi-B transcription factor)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6689
Gene name Gene Name - the full gene name approved by the HGNC.
Spi-B transcription factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SPIB
Synonyms (NCBI Gene) Gene synonyms aliases
SPI-B
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.33
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a transcriptional activator that binds to the PU-box (5`-GAGGAA-3`) and acts as a lymphoid-specific enhancer. Four transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(330)
miRTarBase ID miRNA Experiments Reference
MIRT661108 hsa-miR-3664-5p HITS-CLIP 23824327
MIRT661107 hsa-miR-6504-3p HITS-CLIP 23824327
MIRT661106 hsa-miR-4639-3p HITS-CLIP 23824327
MIRT661105 hsa-miR-5693 HITS-CLIP 23824327
MIRT661104 hsa-miR-6499-3p HITS-CLIP 23824327
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(2)
Transcription factor Regulation Reference
POU2AF1 Unknown 24801987
POU2F2 Unknown 24801987
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(12)
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IMP 10196196
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IMP 10196196
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
606802 11242 ENSG00000269404
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
UniProt ID Q01892
Protein name Transcription factor Spi-B
Protein function Sequence specific transcriptional activator which binds to the PU-box, a purine-rich DNA sequence (5'-GAGGAA-3') that can act as a lymphoid-specific enhancer. Promotes development of plasmacytoid dendritic cells (pDCs), also known as type 2 DC p
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00178 Ets 170 → 252 Ets-domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in plasmacytoid dendritic cells (pDCs) and B-cells, not expressed in T-cells or granulocytes. May also be enriched in stem cell populations of the liver. {ECO:0000269|PubMed:11841448, ECO:0000269|PubMed:12393575}.
Sequence 
MLALEAAQLDGPHFSCLYPDGVFYDLDSCKHSSYPDSEGAPDSLWDWTVAPPVPATPYEA
FDPAAAAFSHPQAAQLCYEPPTYSPAGNLELAPSLEAPGPGLPAYPTENFASQTLVPPAY
APYPSPVLSEEEDLPLDSPALEVSDSESDEALVAGPEGKGSEAGTRKKLRLYQFLLGLLT
RGDMRECVWWVEPGAGVFQFSSKHKELLARRWGQQKGNRKRMTYQKLARALRNYAKTGEI
RKVKRKLTYQFDSALLPAVRRA
Sequence length 262
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Liver failure Liver Failure rs118203990, rs118203991, rs118203992, rs387907022, rs201861847, rs796065037, rs759315662, rs368196005, rs796052121, rs369437593, rs367683258, rs766314948, rs368085185, rs770446752, rs753039116
View all (10 more)
Osteoporosis Osteoporosis rs72658152, rs72667023, rs587776916, rs72656370, rs768615287
Show/Hide Unknown Diseases (3)
Unknown
Disease term Disease name Evidence References Source
Celiac disease Celiac Disease ClinVar
Cirrhosis Cirrhosis ClinVar
Biliary Cholangitis Biliary Cholangitis GWAS
Show/Hide Text Mining Associations (30)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32508318, 37770496
Breast Neoplasms Associate 26099425, 36581948, 37596527, 37684436
Carcinogenesis Associate 25070814
Colorectal Neoplasms Associate 34841706, 35969172
Coronary Disease Associate 23539213
Crohn Disease Associate 35158099
Heart Failure Associate 37684436
Hodgkin Disease Associate 26473286
Leukemia Associate 30986496, 36169277
Leukemia B Cell Associate 17353367