Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6674
Gene name Gene Name - the full gene name approved by the HGNC.
Sperm associated antigen 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SPAG1
Synonyms (NCBI Gene) Gene synonyms aliases
CILD28, CT140, DNAAF13, HEL-S-268, HSD-3.8, SP75, TPIS
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q22.2
Summary Summary of gene provided in NCBI Entrez Gene.
The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targete
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs201740530 C>T Pathogenic Non coding transcript variant, stop gained, intron variant, coding sequence variant, genic downstream transcript variant
rs397518458 T>G Pathogenic Non coding transcript variant, missense variant, initiator codon variant, intron variant
rs397518459 G>T Pathogenic Coding sequence variant, non coding transcript variant, stop gained
rs751845138 GAGTA>- Pathogenic Coding sequence variant, non coding transcript variant, frameshift variant
rs752479330 A>T Pathogenic Coding sequence variant, non coding transcript variant, stop gained, 5 prime UTR variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020441 hsa-miR-106b-5p Microarray 17242205
MIRT027357 hsa-miR-101-3p Sequencing 20371350
MIRT029638 hsa-miR-26b-5p Microarray 19088304
MIRT027357 hsa-miR-101-3p PAR-CLIP 20371350
MIRT561142 hsa-miR-144-3p PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0005525 Function GTP binding IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IDA 16983343
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603395 11212 ENSG00000104450
Protein
UniProt ID Q07617
Protein name Sperm-associated antigen 1 (HSD-3.8) (Infertility-related sperm protein Spag-1)
Protein function May play a role in the cytoplasmic assembly of the ciliary dynein arms (By similarity). May play a role in fertilization. Binds GTP and has GTPase activity.
PDB 6I57 , 7BEV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00515 TPR_1 657 690 Tetratricopeptide repeat Repeat
PF13877 RPAP3_C 802 894 Potential Monad-binding region of RPAP3 Domain
Tissue specificity TISSUE SPECIFICITY: Present in most tissues, including lung, with the strongest expression in brain, colon, kidney, and testis. In sperm and testis, detected in particular in pachytene primary spermatocytes. Up-regulated in pancreatic tumor tissues and no
Sequence
MTTKDYPSLWGFGTTKTFKIPIEHLDFKYIEKCSDVKHLEKILCVLRSGEEGYYPELTEF
CEKHLQALAPESRALRKDKPAATAASFTAEEWEKIDGDIKSWVSEIKKEEDKMHFHETET
FPAMKDNLPPVRGSNSCLHVGKEKYSKRPTKKKTPRDYAEWDKFDVEKECLKIDEDYKEK
TVIDKSHLSKIETRIDTAGLTEKEKDFLATREKEKGNEAFNSGDYEEAVMYYTRSISALP
TVVAYNNRAQAEIKLQNWNSAFQDCEKVLELEPGNVKALLRRATTYKHQNKLREATEDLS
KVLDVEPDNDLAKKTLSEVERDLKNSEAASETQTKGKRMVIQEIENSEDEEGKSGRKHED
GGGDKKPAEPAGAARAAQPCVMGNIQKKLTGKAEGGKRPARGAPQRGQTPEAGADKRSPR
RASAAAAAGGGATGHPGGGQGAENPAGLKSQGNELFRSGQFAEAAGKYSAAIALLEPAGS
EIADDLSILYSNRAACYLKEGNCSGCIQDCNRALELHPFSMKPLLRRAMAYETLEQYGKA
YVDYKTVLQIDCGLQLANDSVNRLSRILMELDGPNWREKLSPIPAVPASVPLQAWHPAKE
MISKQAGDSSSHRQQGITDEKTFKALKEEGNQCVNDKNYKDALSKYSECLKINNKECAIY
TNRALCYLKLCQFEEAKQDCDQALQLADGN
VKAFYRRALAHKGLKNYQKSLIDLNKVILL
DPSIIEAKMELEEVTRLLNLKDKTAPFNKEKERRKIEIQEVNEGKEEPGRPAGEVSMGCL
ASEKGGKSSRSPEDPEKLPIAKPNNAYEFGQIINALSTRKDKEACAHLLAITAPKDLPMF
LSNKLEGDTFLLLIQSLKNNLIEKDPSLVYQHLLYLSKAERFKMMLTLISKGQK
ELIEQL
FEDLSDTPNNHFTLEDIQALKRQYEL
Sequence length 926
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Ciliary dyskinesia Primary ciliary dyskinesia 28, primary ciliary dyskinesia rs1380083184, rs1563815206, rs886037653, rs770251775, rs1060503107, rs973819096, rs752479330, rs1818211696, rs1060503104, rs397518458, rs763569711, rs751845138, rs1275662909, rs201740530, rs1229952265 N/A
Kartagener Syndrome kartagener syndrome rs201740530 N/A
Nocturnal Epilepsy Autosomal dominant nocturnal frontal lobe epilepsy 5 rs886037653, rs397518459, rs201740530 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 40183343
Carcinoma Embryonal Associate 17993720
Ciliary Motility Disorders Associate 33577779, 33739091, 35178554
Endometriosis Associate 39411815
Fetal Growth Retardation Associate 29241932
Focal Cortical Dysplasia Associate 38491953
Genetic Diseases Inborn Associate 29241932
Infertility Associate 35178554
Laterality Defects Autosomal Dominant Associate 35178554
Leukemia Myeloid Acute Associate 35227274