SOD3 (superoxide dismutase 3)

Gene

• Entrez ID: 6649
• Gene name: Superoxide dismutase 3
• Gene symbol: SOD3
• Synonyms (NCBI Gene): EC-SOD
• Chromosome: 4
• Chromosome location: 4p15.2
• Summary: This gene encodes a member of the superoxide dismutase (SOD) protein family. SODs are antioxidant enzymes that catalyze the conversion of superoxide radicals into hydrogen peroxide and oxygen, which may protect the brain, lungs, and other tissues from oxi

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1799895	C>G	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006997	hsa-miR-21-5p	miRGen"	22836756
MIRT1379228	hsa-miR-1193	CLIP-seq
MIRT1379229	hsa-miR-193a-5p	CLIP-seq
MIRT1379230	hsa-miR-2392	CLIP-seq
MIRT1379231	hsa-miR-3202	CLIP-seq
MIRT1379232	hsa-miR-3664-3p	CLIP-seq
MIRT1379233	hsa-miR-4533	CLIP-seq
MIRT1379234	hsa-miR-541	CLIP-seq
MIRT1379235	hsa-miR-654-5p	CLIP-seq
MIRT2113214	hsa-miR-1293	CLIP-seq
MIRT2113215	hsa-miR-3150a-3p	CLIP-seq
MIRT2113216	hsa-miR-3175	CLIP-seq
MIRT2113217	hsa-miR-4483	CLIP-seq
MIRT2113218	hsa-miR-4728-5p	CLIP-seq
MIRT2113219	hsa-miR-491-5p	CLIP-seq
MIRT1379234	hsa-miR-541	CLIP-seq
MIRT1379235	hsa-miR-654-5p	CLIP-seq
MIRT2113220	hsa-miR-939	CLIP-seq
MIRT2113214	hsa-miR-1293	CLIP-seq
MIRT2113216	hsa-miR-3175	CLIP-seq
MIRT2336373	hsa-miR-3180	CLIP-seq
MIRT2336374	hsa-miR-3180-3p	CLIP-seq
MIRT2336375	hsa-miR-3196	CLIP-seq
MIRT1379231	hsa-miR-3202	CLIP-seq
MIRT2113217	hsa-miR-4483	CLIP-seq
MIRT2336376	hsa-miR-744	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0004784	Function	Superoxide dismutase activity	IBA
GO:0004784	Function	Superoxide dismutase activity	IEA
GO:0004784	Function	Superoxide dismutase activity	TAS	8034674
GO:0005507	Function	Copper ion binding	IBA
GO:0005507	Function	Copper ion binding	IEA
GO:0005515	Function	Protein binding	IPI	15528465, 16371425, 25416956, 32296183
GO:0005576	Component	Extracellular region	HDA	20551380
GO:0005576	Component	Extracellular region	HDA	27068509, 27559042
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	20551380
GO:0005615	Component	Extracellular space	IDA	9699963
GO:0005615	Component	Extracellular space	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005796	Component	Golgi lumen	TAS
GO:0006801	Process	Superoxide metabolic process	IEA
GO:0008201	Function	Heparin binding	IEA
GO:0016209	Function	Antioxidant activity	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0019430	Process	Removal of superoxide radicals	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0060090	Function	Molecular adaptor activity	EXP	19289127
GO:0070062	Component	Extracellular exosome	HDA	23533145

Other IDs

• MIM: 185490
• HGNC: 11181
• e!Ensembl: ENSG00000109610

Protein

• UniProt ID: P08294
• Protein name: Extracellular superoxide dismutase [Cu-Zn] (EC-SOD) (EC 1.15.1.1)
• Protein function: Protect the extracellular space from toxic effect of reactive oxygen intermediates by converting superoxide radicals into hydrogen peroxide and oxygen.
• PDB: 2JLP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00080	Sod_Cu	72 → 210	Copper/zinc superoxide dismutase (SODC)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in blood vessels, heart, lung, kidney and placenta. Major SOD isoenzyme in extracellular fluids such as plasma, lymph and synovial fluid.
• Sequence:

  MLALLCSCLLLAAGASDAWTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGALH
  AACQVQPSATLDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGD
  LSQGCESTGPHYNPLAVPHPQHPGDFGNFAVRDGSLWRYRAGLAASLAGPHSIVGRAVVV
  HAGEDDLGRGGNQASVENGNAGRRLACCVVGVCGPGLWERQAREHSERKKRRRESECKAA
  

• Sequence length: 240

Pathways

Reactome:

Detoxification of Reactive Oxygen Species

<