Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	664
Gene name Gene Name - the full gene name approved by the HGNC.	BCL2 interacting protein 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	BNIP3
Synonyms (NCBI Gene) Gene synonyms aliases	HABON, NIP3
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q26.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is encodes a mitochondrial protein that contains a BH3 domain and acts as a pro-apoptotic factor. The encoded protein interacts with anti-apoptotic proteins, including the E1B 19 kDa protein and Bcl2. This gene is silenced in tumors by DNA methy

Show/Hide all(138)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000305	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	20332243
MIRT000305	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	20332243
MIRT000305	hsa-miR-145-5p	Luciferase reporter assay	20332243
MIRT004753	hsa-miR-221-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	20018759
MIRT000305	hsa-miR-145-5p	Microarray, qRT-PCR	22815788
MIRT437693	hsa-miR-27a-3p	Microarray, qRT-PCR	22815788
MIRT437701	hsa-miR-27b-3p	Microarray, qRT-PCR	22815788
MIRT437785	hsa-miR-210-3p	Luciferase reporter assay, qRT-PCR, Western blot	23688833
MIRT437693	hsa-miR-27a-3p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR	31923741
MIRT437785	hsa-miR-210-3p	Microarray, qRT-PCR	35816043
MIRT823404	hsa-miR-103a	CLIP-seq
MIRT823405	hsa-miR-107	CLIP-seq
MIRT823406	hsa-miR-1204	CLIP-seq
MIRT823407	hsa-miR-1267	CLIP-seq
MIRT823408	hsa-miR-214	CLIP-seq
MIRT823409	hsa-miR-3610	CLIP-seq
MIRT823410	hsa-miR-3619-5p	CLIP-seq
MIRT823411	hsa-miR-3674	CLIP-seq
MIRT823412	hsa-miR-3914	CLIP-seq
MIRT823413	hsa-miR-4291	CLIP-seq
MIRT823414	hsa-miR-4297	CLIP-seq
MIRT823415	hsa-miR-4310	CLIP-seq
MIRT823416	hsa-miR-4520a-3p	CLIP-seq
MIRT823417	hsa-miR-4520b-3p	CLIP-seq
MIRT823418	hsa-miR-4529-3p	CLIP-seq
MIRT823419	hsa-miR-4652-3p	CLIP-seq
MIRT823420	hsa-miR-4682	CLIP-seq
MIRT823421	hsa-miR-4685-5p	CLIP-seq
MIRT823422	hsa-miR-4701-5p	CLIP-seq
MIRT823423	hsa-miR-548a-3p	CLIP-seq
MIRT823424	hsa-miR-548a-5p	CLIP-seq
MIRT823425	hsa-miR-548ab	CLIP-seq
MIRT823426	hsa-miR-548ak	CLIP-seq
MIRT823427	hsa-miR-548b-5p	CLIP-seq
MIRT823428	hsa-miR-548c-5p	CLIP-seq
MIRT823429	hsa-miR-548d-5p	CLIP-seq
MIRT823430	hsa-miR-548e	CLIP-seq
MIRT823431	hsa-miR-548f	CLIP-seq
MIRT823432	hsa-miR-548h	CLIP-seq
MIRT823433	hsa-miR-548i	CLIP-seq
MIRT823434	hsa-miR-548j	CLIP-seq
MIRT823435	hsa-miR-548k	CLIP-seq
MIRT823436	hsa-miR-548l	CLIP-seq
MIRT823437	hsa-miR-548w	CLIP-seq
MIRT823438	hsa-miR-548y	CLIP-seq
MIRT823439	hsa-miR-559	CLIP-seq
MIRT823440	hsa-miR-562	CLIP-seq
MIRT823441	hsa-miR-588	CLIP-seq
MIRT823442	hsa-miR-761	CLIP-seq
MIRT823443	hsa-miR-922	CLIP-seq
MIRT1545774	hsa-miR-128	CLIP-seq
MIRT1545775	hsa-miR-27a	CLIP-seq
MIRT1545776	hsa-miR-27b	CLIP-seq
MIRT1545777	hsa-miR-3647-3p	CLIP-seq
MIRT1545778	hsa-miR-411	CLIP-seq
MIRT1545779	hsa-miR-4282	CLIP-seq
MIRT1545780	hsa-miR-4699-3p	CLIP-seq
MIRT1545781	hsa-miR-5096	CLIP-seq
MIRT1545782	hsa-miR-513a-5p	CLIP-seq
MIRT1545783	hsa-miR-936	CLIP-seq
MIRT823407	hsa-miR-1267	CLIP-seq
MIRT1943469	hsa-miR-1298	CLIP-seq
MIRT823411	hsa-miR-3674	CLIP-seq
MIRT1943470	hsa-miR-3678-3p	CLIP-seq
MIRT1943471	hsa-miR-410	CLIP-seq
MIRT1943472	hsa-miR-4276	CLIP-seq
MIRT823419	hsa-miR-4652-3p	CLIP-seq
MIRT1943473	hsa-miR-4680-3p	CLIP-seq
MIRT823420	hsa-miR-4682	CLIP-seq
MIRT1943474	hsa-miR-4775	CLIP-seq
MIRT1943475	hsa-miR-590-3p	CLIP-seq
MIRT1943476	hsa-miR-664	CLIP-seq
MIRT2182094	hsa-miR-1276	CLIP-seq
MIRT2182095	hsa-miR-145	CLIP-seq
MIRT2182096	hsa-miR-197	CLIP-seq
MIRT2182097	hsa-miR-2467-3p	CLIP-seq
MIRT2182098	hsa-miR-3180-5p	CLIP-seq
MIRT2182099	hsa-miR-3591-5p	CLIP-seq
MIRT2182100	hsa-miR-3660	CLIP-seq
MIRT823411	hsa-miR-3674	CLIP-seq
MIRT1943470	hsa-miR-3678-3p	CLIP-seq
MIRT2182101	hsa-miR-3691-3p	CLIP-seq
MIRT2182102	hsa-miR-3925-3p	CLIP-seq
MIRT1545778	hsa-miR-411	CLIP-seq
MIRT1943472	hsa-miR-4276	CLIP-seq
MIRT2182103	hsa-miR-4277	CLIP-seq
MIRT2182104	hsa-miR-4280	CLIP-seq
MIRT2182105	hsa-miR-4311	CLIP-seq
MIRT2182106	hsa-miR-4328	CLIP-seq
MIRT2182107	hsa-miR-4494	CLIP-seq
MIRT2182108	hsa-miR-4526	CLIP-seq
MIRT823420	hsa-miR-4682	CLIP-seq
MIRT2182109	hsa-miR-4684-3p	CLIP-seq
MIRT2182110	hsa-miR-4765	CLIP-seq
MIRT1943474	hsa-miR-4775	CLIP-seq
MIRT2182111	hsa-miR-4781-3p	CLIP-seq
MIRT2182112	hsa-miR-499a-5p	CLIP-seq
MIRT2182113	hsa-miR-508-5p	CLIP-seq
MIRT823424	hsa-miR-548a-5p	CLIP-seq
MIRT823425	hsa-miR-548ab	CLIP-seq
MIRT823426	hsa-miR-548ak	CLIP-seq
MIRT823427	hsa-miR-548b-5p	CLIP-seq
MIRT823428	hsa-miR-548c-5p	CLIP-seq
MIRT823429	hsa-miR-548d-5p	CLIP-seq
MIRT823432	hsa-miR-548h	CLIP-seq
MIRT823433	hsa-miR-548i	CLIP-seq
MIRT823434	hsa-miR-548j	CLIP-seq
MIRT823435	hsa-miR-548k	CLIP-seq
MIRT823436	hsa-miR-548l	CLIP-seq
MIRT823437	hsa-miR-548w	CLIP-seq
MIRT823438	hsa-miR-548y	CLIP-seq
MIRT823439	hsa-miR-559	CLIP-seq
MIRT2182114	hsa-miR-583	CLIP-seq
MIRT1943475	hsa-miR-590-3p	CLIP-seq
MIRT2182115	hsa-miR-622	CLIP-seq
MIRT2182116	hsa-miR-640	CLIP-seq
MIRT2182117	hsa-miR-759	CLIP-seq
MIRT2182118	hsa-miR-944	CLIP-seq
MIRT823404	hsa-miR-103a	CLIP-seq
MIRT823405	hsa-miR-107	CLIP-seq
MIRT2182099	hsa-miR-3591-5p	CLIP-seq
MIRT823412	hsa-miR-3914	CLIP-seq
MIRT823415	hsa-miR-4310	CLIP-seq
MIRT2485680	hsa-miR-4731-3p	CLIP-seq
MIRT2485681	hsa-miR-4796-5p	CLIP-seq
MIRT2485682	hsa-miR-4801	CLIP-seq
MIRT2182116	hsa-miR-640	CLIP-seq
MIRT2182118	hsa-miR-944	CLIP-seq
MIRT823404	hsa-miR-103a	CLIP-seq
MIRT823405	hsa-miR-107	CLIP-seq
MIRT2182099	hsa-miR-3591-5p	CLIP-seq
MIRT823412	hsa-miR-3914	CLIP-seq
MIRT823415	hsa-miR-4310	CLIP-seq
MIRT2485680	hsa-miR-4731-3p	CLIP-seq
MIRT2485681	hsa-miR-4796-5p	CLIP-seq
MIRT2485682	hsa-miR-4801	CLIP-seq
MIRT2182116	hsa-miR-640	CLIP-seq
MIRT2182118	hsa-miR-944	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
HIF1A	Activation	17848618
HIF1A	Unknown	17513511

Show/Hide all(72)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000422	Process	Autophagy of mitochondrion	NAS	22505714
GO:0001666	Process	Response to hypoxia	ISS
GO:0005515	Function	Protein binding	IPI	7954800, 10381623, 15868100, 16189514, 17360363, 18371312, 19060904, 20436456, 21516116, 22292033, 24981860, 25416956, 27107012, 27499296, 28514442, 32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	ISS
GO:0005635	Component	Nuclear envelope	IBA	21873635
GO:0005635	Component	Nuclear envelope	IDA	7954800
GO:0005654	Component	Nucleoplasm	ISS
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	IDA	7954800, 9396766, 18371312
GO:0005739	Component	Mitochondrion	TAS	9973195
GO:0005741	Component	Mitochondrial outer membrane	IBA	21873635
GO:0005741	Component	Mitochondrial outer membrane	IDA	22292033
GO:0005783	Component	Endoplasmic reticulum	IBA	21873635
GO:0005783	Component	Endoplasmic reticulum	NAS	22505714
GO:0006915	Process	Apoptotic process	IPI	7954800
GO:0008219	Process	Cell death	ISS
GO:0009617	Process	Response to bacterium	IEA
GO:0010508	Process	Positive regulation of autophagy	TAS	18309324
GO:0010637	Process	Negative regulation of mitochondrial fusion	IDA	20436456
GO:0010659	Process	Cardiac muscle cell apoptotic process	IEA
GO:0010666	Process	Positive regulation of cardiac muscle cell apoptotic process	IEA
GO:0010917	Process	Negative regulation of mitochondrial membrane potential	IEA
GO:0010940	Process	Positive regulation of necrotic cell death	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0016032	Process	Viral process	IEA
GO:0016239	Process	Positive regulation of macroautophagy	IGI	19273585
GO:0021987	Process	Cerebral cortex development	IEA
GO:0030425	Component	Dendrite	ISS
GO:0031307	Component	Integral component of mitochondrial outer membrane	IDA	10891486
GO:0031966	Component	Mitochondrial membrane	IDA	10891486
GO:0031966	Component	Mitochondrial membrane	IMP	9396766
GO:0035694	Process	Mitochondrial protein catabolic process	IMP	22292033
GO:0042802	Function	Identical protein binding	IPI	10381623, 16189514, 25416956, 27107012, 32296183
GO:0042803	Function	Protein homodimerization activity	IDA	9396766, 10381623
GO:0043065	Process	Positive regulation of apoptotic process	IDA	9973195, 10381623
GO:0043066	Process	Negative regulation of apoptotic process	TAS	7954800
GO:0043067	Process	Regulation of programmed cell death	IBA	21873635
GO:0043068	Process	Positive regulation of programmed cell death	IBA	21873635
GO:0043068	Process	Positive regulation of programmed cell death	IDA	10891486
GO:0043243	Process	Positive regulation of protein-containing complex disassembly	IDA	20436456
GO:0043653	Process	Mitochondrial fragmentation involved in apoptotic process	IDA	20436456
GO:0045837	Process	Negative regulation of membrane potential	IDA	10891486
GO:0046902	Process	Regulation of mitochondrial membrane permeability	IDA	10891486
GO:0048102	Process	Autophagic cell death	IEA
GO:0048678	Process	Response to axon injury	IEA
GO:0048709	Process	Oligodendrocyte differentiation	IEA
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0051020	Function	GTPase binding	IPI	20436456
GO:0051402	Process	Neuron apoptotic process	ISS
GO:0051561	Process	Positive regulation of mitochondrial calcium ion concentration	IEA
GO:0051607	Process	Defense response to virus	IDA	9973195
GO:0055093	Process	Response to hyperoxia	IEA
GO:0060548	Process	Negative regulation of cell death	IGI	19273585
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0071260	Process	Cellular response to mechanical stimulus	IEP
GO:0071279	Process	Cellular response to cobalt ion	IMP	20436456
GO:0071456	Process	Cellular response to hypoxia	IGI	19273585
GO:0071456	Process	Cellular response to hypoxia	IMP	20436456
GO:0072593	Process	Reactive oxygen species metabolic process	IDA	10891486
GO:0090141	Process	Positive regulation of mitochondrial fission	IDA	20436456
GO:0090200	Process	Positive regulation of release of cytochrome c from mitochondria	IDA	20436456
GO:0090649	Process	Response to oxygen-glucose deprivation	IEA
GO:0097345	Process	Mitochondrial outer membrane permeabilization	IBA	21873635
GO:0097345	Process	Mitochondrial outer membrane permeabilization	IDA	18371312
GO:0140507	Process	Granzyme-mediated programmed cell death signaling pathway	IDA	9396766
GO:1901998	Process	Toxin transport	IEA
GO:1902109	Process	Negative regulation of mitochondrial membrane permeability involved in apoptotic process	IEA
GO:1903599	Process	Positive regulation of autophagy of mitochondrion	IEA
GO:1903715	Process	Regulation of aerobic respiration	IEA
GO:1990144	Process	Intrinsic apoptotic signaling pathway in response to hypoxia	IMP	20436456
GO:2000378	Process	Negative regulation of reactive oxygen species metabolic process	IEA

MIM	HGNC	e!Ensembl
603293	1084	ENSG00000176171

Protein

UniProt ID

Q12983

Protein name

BCL2/adenovirus E1B 19 kDa protein-interacting protein 3

Protein function

Apoptosis-inducing protein that can overcome BCL2 suppression. May play a role in repartitioning calcium between the two major intracellular calcium stores in association with BCL2. Involved in mitochondrial quality control via its interaction w

PDB

2J5D , 2KA1 , 2KA2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06553	BNIP3	68 → 259	BNIP3	Family

Sequence

MGDAAADPPGPALPCEFLRPGCGAPLSPGAQLGRGAPTSAFPPPAAEAHPAARRGLRSPQ
LPSGAMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESG
RSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSD
WIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLL
AIGLGIYIGRRLTTSTSTF

Sequence length

259

Interactions

View interactions

	KEGG
	FoxO signaling pathway Mitophagy - animal Autophagy - animal Shigellosis Legionellosis

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802 View all (244 more)	16367923
Multiple myeloma	Multiple Myeloma	rs11540652, rs78311289, rs121913482, rs397507340, rs121913343, rs121913240, rs121913529, rs730882018, rs1057517992, rs121913527, rs756183569, rs746646631, rs1574706907, rs372078034, rs745380962 View all (38 more)	18172295
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	18163427

Show/Hide Text Mining Associations (102)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma Follicular	Associate	28257096
Adenocarcinoma of Lung	Associate	35029906, 40307363
Adenoma Oxyphilic	Associate	28819333
Anemia	Associate	16827797
Arthritis Rheumatoid	Associate	35690741
Atrial Remodeling	Associate	35563877
Atrophy	Stimulate	35605642
Birt Hogg Dube Syndrome	Stimulate	21057536
Brain Neoplasms	Associate	29287594
Breast Neoplasms	Associate	19505343, 27746856, 29287594, 32736587, 34226298, 37610095, 37649051
Carcinoma	Associate	28257096
Carcinoma Adenoid Cystic	Associate	25769455, 26323347, 26847304
Carcinoma Basal Cell	Associate	25181405
Carcinoma Ductal	Associate	25031766
Carcinoma Hepatocellular	Inhibit	12521301
Carcinoma Hepatocellular	Associate	12521301, 17717605, 28869833, 33602168
Carcinoma Lobular	Associate	25031766
Carcinoma Medullary	Associate	28257096
Carcinoma Non Small Cell Lung	Associate	36092153
Carcinoma Pancreatic Ductal	Associate	20808857
Carcinoma Renal Cell	Associate	21057536, 34779489, 35308143, 37649051
Carcinoma Renal Cell	Inhibit	30365137
Carcinoma Squamous Cell	Associate	20849603
Ceroid Lipofuscinosis Neuronal 2	Stimulate	23249249
Cholangiocarcinoma	Associate	25081716
Colonic Neoplasms	Associate	32851835
Colorectal Neoplasms	Associate	18728663
Coronary Disease	Associate	33964876
COVID 19	Associate	36333264
Death	Stimulate	26102349
Drug Related Side Effects and Adverse Reactions	Associate	31159592, 32412667
Esophageal Squamous Cell Carcinoma	Associate	25232961, 27893424
Facial Nerve Diseases	Associate	30551550
Familial cylindromatosis	Associate	25181405
Fibrosis	Associate	36928344
Glioblastoma	Associate	16217754, 19339613, 26467103
Glioma	Associate	18670645, 19339613, 26467103, 32135176, 32597148
Glycogen Storage Disease Type II	Associate	33799647, 35605642
Heart Diseases	Stimulate	20022263
Heart Failure	Associate	35563877
Hypoxia	Associate	15756280, 15790403, 16217754, 16803523, 19802386, 21984181, 25081716, 25769455, 26467103, 28000962, 29207102, 32351020, 35690741
Hypoxia	Stimulate	17763440, 18059169, 18670645, 19505343, 20436456, 20637734, 21573703, 23291726, 24200883, 26102349, 31078780, 33478328, 33496385
Hypoxia Brain	Stimulate	16217754, 16803523, 28000962, 33333786
Hypoxia Brain	Associate	17848618, 25081716, 26059435, 26467103, 36928344
Inflammation	Stimulate	30302028
Inflammation	Associate	30374881
Ischemia	Stimulate	36129061
Laryngeal Neoplasms	Associate	22458929
Leukemia Myeloid Acute	Associate	15756280, 39519080
Lung Neoplasms	Associate	20849603, 30338933
Lung Neoplasms	Stimulate	25950386
Lymphatic Metastasis	Associate	16827797, 25081716, 36454866
Lymphatic Metastasis	Inhibit	19505343
Lymphoma Large B Cell Diffuse	Associate	18288132
Lymphoma Non Hodgkin	Associate	37649051
Malformations of Cortical Development Group I	Associate	36129061
Mastocytosis Systemic	Associate	36333264
Mitochondrial Diseases	Associate	10891486, 22505714, 25891311, 28869833, 33496385, 34095303, 34650122, 36129061, 36928344, 40445405
Mitochondrial Diseases	Stimulate	26102349
Multiple Myeloma	Inhibit	15756280
Multiple Myeloma	Associate	17848618, 19690192, 34189969, 37401850
Muscular Atrophy	Associate	35605642
Myelodysplastic Syndromes	Associate	38038045
Myeloproliferative Disorders	Inhibit	26290261
Myotonic Dystrophy	Associate	38240888
Nasal Polyps	Associate	35747690
Nasopharyngeal Carcinoma	Associate	33313953, 33795637, 38149563, 40083705
Necrosis	Associate	10891486, 25950386, 32412667
Neoplasm Metastasis	Associate	25081716, 34226298
Neoplasms	Associate	15756280, 18838203, 19339613, 20637734, 20849603, 23291726, 25140630, 25719198, 25950386, 26102349, 27085068, 27459917, 27746856, 27893424, 28540987 View all (8 more)
Neoplasms	Stimulate	16217754
Neoplasms	Inhibit	19505343, 24448385
Neoplasms Glandular and Epithelial	Associate	36928344
Neurofibrosarcoma	Associate	24824755
Neurotoxicity Syndromes	Associate	34078255
Optic Atrophy Hereditary Leber	Inhibit	31584786
Optic Atrophy Hereditary Leber	Associate	32157656
Osteoglophonic dwarfism	Associate	36496986
Osteoporotic Fractures	Associate	39456222
Osteosarcoma	Associate	25618603, 34335109, 35459212, 39174890
Ovarian Neoplasms	Associate	27807188, 32412667, 35459212
Pancreatic Intraductal Neoplasms	Associate	22173550
Pancreatic Neoplasms	Associate	17729412, 21573703, 24448385
Pelvic Organ Prolapse	Stimulate	29230415
Peritonitis	Associate	20082478
Pre Eclampsia	Associate	34650122
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Inhibit	15756280
Primary Myelofibrosis	Inhibit	18838203
Prostatic Neoplasms	Associate	15790403
Pulmonary Disease Chronic Obstructive	Associate	30302028
Sarcoma	Associate	37649051
Sleep Deprivation	Associate	20436456
Squamous Cell Carcinoma of Head and Neck	Associate	22458929
Status Asthmaticus	Stimulate	31509440
Stomach Neoplasms	Associate	20082478, 32736677, 40307014
Thrombocythemia Essential	Inhibit	15271793
Thyroid Neoplasms	Associate	28257096
Triple Negative Breast Neoplasms	Associate	35631261
Ureteral Obstruction	Associate	36928344
Urinary Bladder Neoplasms	Associate	24577895
Uterine Cervical Neoplasms	Associate	16803523, 36499465
Uveal melanoma	Associate	29982263

BNIP3 (BCL2 interacting protein 3)