Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	664
Gene name	BCL2 interacting protein 3
Gene symbol	BNIP3
Synonyms (NCBI Gene)	HABONNIP3
Chromosome	10
Chromosome location	10q26.3
Summary	This gene is encodes a mitochondrial protein that contains a BH3 domain and acts as a pro-apoptotic factor. The encoded protein interacts with anti-apoptotic proteins, including the E1B 19 kDa protein and Bcl2. This gene is silenced in tumors by DNA methy

138

Show/Hide all (138)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000305	hsa-miR-145-5p	Luciferase reporter assayqRT-PCRWestern blot	20332243
MIRT000305	hsa-miR-145-5p	Luciferase reporter assayqRT-PCRWestern blot	20332243
MIRT000305	hsa-miR-145-5p	Luciferase reporter assay	20332243
MIRT004753	hsa-miR-221-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	20018759
MIRT000305	hsa-miR-145-5p	MicroarrayqRT-PCR	22815788
MIRT437693	hsa-miR-27a-3p	MicroarrayqRT-PCR	22815788
MIRT437701	hsa-miR-27b-3p	MicroarrayqRT-PCR	22815788
MIRT437785	hsa-miR-210-3p	Luciferase reporter assayqRT-PCRWestern blot	23688833
MIRT437693	hsa-miR-27a-3p	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)qRT-PCR	31923741
MIRT437785	hsa-miR-210-3p	MicroarrayqRT-PCR	35816043
MIRT823404	hsa-miR-103a	CLIP-seq
MIRT823405	hsa-miR-107	CLIP-seq
MIRT823406	hsa-miR-1204	CLIP-seq
MIRT823407	hsa-miR-1267	CLIP-seq
MIRT823408	hsa-miR-214	CLIP-seq
MIRT823409	hsa-miR-3610	CLIP-seq
MIRT823410	hsa-miR-3619-5p	CLIP-seq
MIRT823411	hsa-miR-3674	CLIP-seq
MIRT823412	hsa-miR-3914	CLIP-seq
MIRT823413	hsa-miR-4291	CLIP-seq
MIRT823414	hsa-miR-4297	CLIP-seq
MIRT823415	hsa-miR-4310	CLIP-seq
MIRT823416	hsa-miR-4520a-3p	CLIP-seq
MIRT823417	hsa-miR-4520b-3p	CLIP-seq
MIRT823418	hsa-miR-4529-3p	CLIP-seq
MIRT823419	hsa-miR-4652-3p	CLIP-seq
MIRT823420	hsa-miR-4682	CLIP-seq
MIRT823421	hsa-miR-4685-5p	CLIP-seq
MIRT823422	hsa-miR-4701-5p	CLIP-seq
MIRT823423	hsa-miR-548a-3p	CLIP-seq
MIRT823424	hsa-miR-548a-5p	CLIP-seq
MIRT823425	hsa-miR-548ab	CLIP-seq
MIRT823426	hsa-miR-548ak	CLIP-seq
MIRT823427	hsa-miR-548b-5p	CLIP-seq
MIRT823428	hsa-miR-548c-5p	CLIP-seq
MIRT823429	hsa-miR-548d-5p	CLIP-seq
MIRT823430	hsa-miR-548e	CLIP-seq
MIRT823431	hsa-miR-548f	CLIP-seq
MIRT823432	hsa-miR-548h	CLIP-seq
MIRT823433	hsa-miR-548i	CLIP-seq
MIRT823434	hsa-miR-548j	CLIP-seq
MIRT823435	hsa-miR-548k	CLIP-seq
MIRT823436	hsa-miR-548l	CLIP-seq
MIRT823437	hsa-miR-548w	CLIP-seq
MIRT823438	hsa-miR-548y	CLIP-seq
MIRT823439	hsa-miR-559	CLIP-seq
MIRT823440	hsa-miR-562	CLIP-seq
MIRT823441	hsa-miR-588	CLIP-seq
MIRT823442	hsa-miR-761	CLIP-seq
MIRT823443	hsa-miR-922	CLIP-seq
MIRT1545774	hsa-miR-128	CLIP-seq
MIRT1545775	hsa-miR-27a	CLIP-seq
MIRT1545776	hsa-miR-27b	CLIP-seq
MIRT1545777	hsa-miR-3647-3p	CLIP-seq
MIRT1545778	hsa-miR-411	CLIP-seq
MIRT1545779	hsa-miR-4282	CLIP-seq
MIRT1545780	hsa-miR-4699-3p	CLIP-seq
MIRT1545781	hsa-miR-5096	CLIP-seq
MIRT1545782	hsa-miR-513a-5p	CLIP-seq
MIRT1545783	hsa-miR-936	CLIP-seq
MIRT823407	hsa-miR-1267	CLIP-seq
MIRT1943469	hsa-miR-1298	CLIP-seq
MIRT823411	hsa-miR-3674	CLIP-seq
MIRT1943470	hsa-miR-3678-3p	CLIP-seq
MIRT1943471	hsa-miR-410	CLIP-seq
MIRT1943472	hsa-miR-4276	CLIP-seq
MIRT823419	hsa-miR-4652-3p	CLIP-seq
MIRT1943473	hsa-miR-4680-3p	CLIP-seq
MIRT823420	hsa-miR-4682	CLIP-seq
MIRT1943474	hsa-miR-4775	CLIP-seq
MIRT1943475	hsa-miR-590-3p	CLIP-seq
MIRT1943476	hsa-miR-664	CLIP-seq
MIRT2182094	hsa-miR-1276	CLIP-seq
MIRT2182095	hsa-miR-145	CLIP-seq
MIRT2182096	hsa-miR-197	CLIP-seq
MIRT2182097	hsa-miR-2467-3p	CLIP-seq
MIRT2182098	hsa-miR-3180-5p	CLIP-seq
MIRT2182099	hsa-miR-3591-5p	CLIP-seq
MIRT2182100	hsa-miR-3660	CLIP-seq
MIRT823411	hsa-miR-3674	CLIP-seq
MIRT1943470	hsa-miR-3678-3p	CLIP-seq
MIRT2182101	hsa-miR-3691-3p	CLIP-seq
MIRT2182102	hsa-miR-3925-3p	CLIP-seq
MIRT1545778	hsa-miR-411	CLIP-seq
MIRT1943472	hsa-miR-4276	CLIP-seq
MIRT2182103	hsa-miR-4277	CLIP-seq
MIRT2182104	hsa-miR-4280	CLIP-seq
MIRT2182105	hsa-miR-4311	CLIP-seq
MIRT2182106	hsa-miR-4328	CLIP-seq
MIRT2182107	hsa-miR-4494	CLIP-seq
MIRT2182108	hsa-miR-4526	CLIP-seq
MIRT823420	hsa-miR-4682	CLIP-seq
MIRT2182109	hsa-miR-4684-3p	CLIP-seq
MIRT2182110	hsa-miR-4765	CLIP-seq
MIRT1943474	hsa-miR-4775	CLIP-seq
MIRT2182111	hsa-miR-4781-3p	CLIP-seq
MIRT2182112	hsa-miR-499a-5p	CLIP-seq
MIRT2182113	hsa-miR-508-5p	CLIP-seq
MIRT823424	hsa-miR-548a-5p	CLIP-seq
MIRT823425	hsa-miR-548ab	CLIP-seq
MIRT823426	hsa-miR-548ak	CLIP-seq
MIRT823427	hsa-miR-548b-5p	CLIP-seq
MIRT823428	hsa-miR-548c-5p	CLIP-seq
MIRT823429	hsa-miR-548d-5p	CLIP-seq
MIRT823432	hsa-miR-548h	CLIP-seq
MIRT823433	hsa-miR-548i	CLIP-seq
MIRT823434	hsa-miR-548j	CLIP-seq
MIRT823435	hsa-miR-548k	CLIP-seq
MIRT823436	hsa-miR-548l	CLIP-seq
MIRT823437	hsa-miR-548w	CLIP-seq
MIRT823438	hsa-miR-548y	CLIP-seq
MIRT823439	hsa-miR-559	CLIP-seq
MIRT2182114	hsa-miR-583	CLIP-seq
MIRT1943475	hsa-miR-590-3p	CLIP-seq
MIRT2182115	hsa-miR-622	CLIP-seq
MIRT2182116	hsa-miR-640	CLIP-seq
MIRT2182117	hsa-miR-759	CLIP-seq
MIRT2182118	hsa-miR-944	CLIP-seq
MIRT823404	hsa-miR-103a	CLIP-seq
MIRT823405	hsa-miR-107	CLIP-seq
MIRT2182099	hsa-miR-3591-5p	CLIP-seq
MIRT823412	hsa-miR-3914	CLIP-seq
MIRT823415	hsa-miR-4310	CLIP-seq
MIRT2485680	hsa-miR-4731-3p	CLIP-seq
MIRT2485681	hsa-miR-4796-5p	CLIP-seq
MIRT2485682	hsa-miR-4801	CLIP-seq
MIRT2182116	hsa-miR-640	CLIP-seq
MIRT2182118	hsa-miR-944	CLIP-seq
MIRT823404	hsa-miR-103a	CLIP-seq
MIRT823405	hsa-miR-107	CLIP-seq
MIRT2182099	hsa-miR-3591-5p	CLIP-seq
MIRT823412	hsa-miR-3914	CLIP-seq
MIRT823415	hsa-miR-4310	CLIP-seq
MIRT2485680	hsa-miR-4731-3p	CLIP-seq
MIRT2485681	hsa-miR-4796-5p	CLIP-seq
MIRT2485682	hsa-miR-4801	CLIP-seq
MIRT2182116	hsa-miR-640	CLIP-seq
MIRT2182118	hsa-miR-944	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
HIF1A	Activation	17848618
HIF1A	Unknown	17513511

Show/Hide all (87)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000422	Process	Autophagy of mitochondrion	NAS	22505714
GO:0000423	Process	Mitophagy	IMP	22505714
GO:0001666	Process	Response to hypoxia	IEA
GO:0001666	Process	Response to hypoxia	ISS
GO:0005515	Function	Protein binding	IPI	7954800, 10381623, 15868100, 16189514, 17360363, 18371312, 19060904, 20436456, 21516116, 22292033, 24981860, 25416956, 27107012, 27499296, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005635	Component	Nuclear envelope	IBA
GO:0005635	Component	Nuclear envelope	IDA	7954800
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	7954800, 9396766, 18371312
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	TAS	9973195
GO:0005740	Component	Mitochondrial envelope	IEA
GO:0005741	Component	Mitochondrial outer membrane	IBA
GO:0005741	Component	Mitochondrial outer membrane	IDA	22505714
GO:0005741	Component	Mitochondrial outer membrane	IDA	10891486, 22292033
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	NAS	22505714
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	22505714
GO:0006915	Process	Apoptotic process	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0010508	Process	Positive regulation of autophagy	TAS	18309324
GO:0010637	Process	Negative regulation of mitochondrial fusion	IDA	20436456
GO:0010659	Process	Cardiac muscle cell apoptotic process	IEA
GO:0010666	Process	Positive regulation of cardiac muscle cell apoptotic process	IEA
GO:0010917	Process	Negative regulation of mitochondrial membrane potential	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0016020	Component	Membrane	IEA
GO:0016239	Process	Positive regulation of macroautophagy	IGI	19273585
GO:0021987	Process	Cerebral cortex development	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0031966	Component	Mitochondrial membrane	IDA	10891486
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0031966	Component	Mitochondrial membrane	IMP	9396766
GO:0035694	Process	Mitochondrial protein catabolic process	IMP	22292033
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	10381623, 16189514, 25416956, 27107012, 32296183
GO:0042803	Function	Protein homodimerization activity	IDA	9396766, 10381623
GO:0043065	Process	Positive regulation of apoptotic process	IDA	9973195, 10381623
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	TAS	7954800
GO:0043068	Process	Positive regulation of programmed cell death	IBA
GO:0043068	Process	Positive regulation of programmed cell death	IDA	10891486
GO:0043069	Process	Negative regulation of programmed cell death	IGI	19273585
GO:0043243	Process	Positive regulation of protein-containing complex disassembly	IDA	20436456
GO:0043653	Process	Mitochondrial fragmentation involved in apoptotic process	IDA	20436456
GO:0045837	Process	Negative regulation of membrane potential	IDA	10891486
GO:0046902	Process	Regulation of mitochondrial membrane permeability	IDA	10891486
GO:0048102	Process	Autophagic cell death	IEA
GO:0048678	Process	Response to axon injury	IEA
GO:0048709	Process	Oligodendrocyte differentiation	IEA
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0051020	Function	GTPase binding	IPI	20436456
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051402	Process	Neuron apoptotic process	ISS
GO:0051561	Process	Positive regulation of mitochondrial calcium ion concentration	IEA
GO:0051607	Process	Defense response to virus	IDA	9973195
GO:0055093	Process	Response to hyperoxia	IEA
GO:0061709	Process	Reticulophagy	IMP	22505714
GO:0061753	Process	Substrate localization to autophagosome	IEA
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0071260	Process	Cellular response to mechanical stimulus	IEP
GO:0071279	Process	Cellular response to cobalt ion	IMP	20436456
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071456	Process	Cellular response to hypoxia	IGI	19273585
GO:0071456	Process	Cellular response to hypoxia	IMP	20436456
GO:0072593	Process	Reactive oxygen species metabolic process	IDA	10891486
GO:0090141	Process	Positive regulation of mitochondrial fission	IDA	20436456
GO:0090200	Process	Positive regulation of release of cytochrome c from mitochondria	IDA	20436456
GO:0090649	Process	Response to oxygen-glucose deprivation	IEA
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IEA
GO:0097345	Process	Mitochondrial outer membrane permeabilization	IBA
GO:0097345	Process	Mitochondrial outer membrane permeabilization	IDA	18371312
GO:0140506	Function	Endoplasmic reticulum-autophagosome adaptor activity	IDA	22505714
GO:0140507	Process	Granzyme-mediated programmed cell death signaling pathway	IDA	9396766
GO:0140580	Function	Mitochondrion autophagosome adaptor activity	IDA	22505714
GO:1902109	Process	Negative regulation of mitochondrial membrane permeability involved in apoptotic process	IEA
GO:1903599	Process	Positive regulation of autophagy of mitochondrion	IEA
GO:1990144	Process	Intrinsic apoptotic signaling pathway in response to hypoxia	IMP	20436456

MIM	HGNC	e!Ensembl
603293	1084	ENSG00000176171

Q12983

Protein name

BCL2/adenovirus E1B 19 kDa protein-interacting protein 3

Protein function

Apoptosis-inducing protein that can overcome BCL2 suppression. May play a role in repartitioning calcium between the two major intracellular calcium stores in association with BCL2. Involved in mitochondrial quality control via its interaction w

PDB

2J5D , 2KA1 , 2KA2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06553	BNIP3	68 → 259	BNIP3	Family

Sequence

MGDAAADPPGPALPCEFLRPGCGAPLSPGAQLGRGAPTSAFPPPAAEAHPAARRGLRSPQ
LPSGAMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESG
RSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSD
WIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLL
AIGLGIYIGRRLTTSTSTF

Sequence length

259

Interactions

View interactions

	KEGG
	FoxO signaling pathway Mitophagy - animal Autophagy - animal Shigellosis Legionellosis

BNIP3 (BCL2 interacting protein 3)