Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6634
Gene name Gene Name - the full gene name approved by the HGNC.
Small nuclear ribonucleoprotein D3 polypeptide
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SNRPD3
Synonyms (NCBI Gene) Gene synonyms aliases
SMD3, Sm-D3
Chromosome Chromosome number
22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
22q11.23
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a core component of the spliceosome, which is a nuclear ribonucleoprotein complex that functions in pre-mRNA splicing. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT023211 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT024990 hsa-miR-183-5p Sequencing 20371350
MIRT030561 hsa-miR-24-3p Microarray 19748357
MIRT044049 hsa-miR-363-3p CLASH 23622248
MIRT043833 hsa-miR-330-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000243 Component Commitment complex IBA 21873635
GO:0000387 Process Spliceosomal snRNP assembly IBA 21873635
GO:0000387 Process Spliceosomal snRNP assembly IDA 18984161
GO:0000387 Process Spliceosomal snRNP assembly TAS
GO:0000398 Process MRNA splicing, via spliceosome IC 11991638
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601062 11160 ENSG00000100028
Protein
UniProt ID P62318
Protein name Small nuclear ribonucleoprotein Sm D3 (Sm-D3) (snRNP core protein D3)
Protein function Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome (PubMed:11991638, PubMed:18984161, PubMed:19325628, PubMed:25555158, Pu
PDB 1D3B , 3CW1 , 3JCR , 3PGW , 3VRI , 4PJO , 4WZJ , 5MQF , 5O9Z , 5XJC , 5YZG , 5Z56 , 5Z57 , 5Z58 , 6AH0 , 6AHD , 6FF7 , 6ICZ , 6ID0 , 6ID1 , 6QDV , 6QW6 , 6QX9 , 6V4X , 6Y53 , 6Y5Q , 7A5P , 7ABG , 7ABI , 7B0Y , 7DVQ , 7EVO , 7QTT , 7VPX , 7W59 , 7W5A , 7W5B , 8C6J , 8CH6 , 8H6E , 8H6J , 8H6K , 8H6L , 8HK1 , 8I0P , 8I0R , 8I0S , 8I0T , 8I0U , 8I0V , 8I0W
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01423 LSM 8 73 LSM domain Domain
Sequence
MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQ
VYIRGSKIRFLIL
PDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGN
IFQKRR
Sequence length 126
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Spliceosome
Systemic lupus erythematosus
  SLBP independent Processing of Histone Pre-mRNAs
snRNP Assembly
mRNA Splicing - Major Pathway
mRNA Splicing - Minor Pathway
RNA Polymerase II Transcription Termination
SLBP Dependent Processing of Replication-Dependent Histone Pre-mRNAs
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Carcinoma Carcinoma, Carcinoma, Spindle-Cell, Undifferentiated carcinoma rs121912654, rs555607708, rs786202962, rs1564055259 16316942
Associations from Text Mining
Disease Name Relationship Type References
Carcinogenesis Associate 38049564
Carcinoma Non Small Cell Lung Associate 28296343
Drug Related Side Effects and Adverse Reactions Associate 28296343
Huntington Disease Associate 33049985
Lupus Erythematosus Systemic Associate 22363785
Neuroblastoma Associate 38049564