Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6631
Gene name	Small nuclear ribonucleoprotein polypeptide C
Gene symbol	SNRPC
Synonyms (NCBI Gene)	U1CYhc1
Chromosome	6
Chromosome location	6p21.31
Summary	This gene encodes one of the specific protein components of the U1 small nuclear ribonucleoprotein (snRNP) particle required for the formation of the spliceosome. The encoded protein participates in the processing of nuclear precursor messenger RNA splici

179

Show/Hide all (179)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023480	hsa-miR-23b-3p	Sequencing	20371350
MIRT027399	hsa-miR-98-5p	Microarray	19088304
MIRT028793	hsa-miR-26b-5p	Microarray	19088304
MIRT031425	hsa-miR-16-5p	Microarray	21199864
MIRT052477	hsa-let-7a-5p	CLASH	23622248
MIRT051360	hsa-let-7f-5p	CLASH	23622248
MIRT038366	hsa-miR-296-3p	CLASH	23622248
MIRT037015	hsa-miR-877-3p	CLASH	23622248
MIRT1376125	hsa-miR-103a	CLIP-seq
MIRT1376126	hsa-miR-107	CLIP-seq
MIRT1376127	hsa-miR-1197	CLIP-seq
MIRT1376128	hsa-miR-1264	CLIP-seq
MIRT1376129	hsa-miR-129-5p	CLIP-seq
MIRT1376130	hsa-miR-1323	CLIP-seq
MIRT1376131	hsa-miR-15a	CLIP-seq
MIRT1376132	hsa-miR-15b	CLIP-seq
MIRT1376133	hsa-miR-16	CLIP-seq
MIRT1376134	hsa-miR-195	CLIP-seq
MIRT1376135	hsa-miR-1976	CLIP-seq
MIRT1376136	hsa-miR-217	CLIP-seq
MIRT1376137	hsa-miR-219-1-3p	CLIP-seq
MIRT1376138	hsa-miR-2355-3p	CLIP-seq
MIRT1376139	hsa-miR-23a	CLIP-seq
MIRT1376140	hsa-miR-23b	CLIP-seq
MIRT1376141	hsa-miR-23c	CLIP-seq
MIRT1376142	hsa-miR-3148	CLIP-seq
MIRT1376143	hsa-miR-3156-3p	CLIP-seq
MIRT1376144	hsa-miR-3163	CLIP-seq
MIRT1376145	hsa-miR-323b-3p	CLIP-seq
MIRT1376146	hsa-miR-376a	CLIP-seq
MIRT1376147	hsa-miR-376b	CLIP-seq
MIRT1376148	hsa-miR-424	CLIP-seq
MIRT1376149	hsa-miR-4299	CLIP-seq
MIRT1376150	hsa-miR-4301	CLIP-seq
MIRT1376151	hsa-miR-4646-3p	CLIP-seq
MIRT1376152	hsa-miR-4695-3p	CLIP-seq
MIRT1376153	hsa-miR-4713-5p	CLIP-seq
MIRT1376154	hsa-miR-4728-3p	CLIP-seq
MIRT1376155	hsa-miR-4753-3p	CLIP-seq
MIRT1376156	hsa-miR-4766-5p	CLIP-seq
MIRT1376157	hsa-miR-4773	CLIP-seq
MIRT1376158	hsa-miR-4797-3p	CLIP-seq
MIRT1376159	hsa-miR-497	CLIP-seq
MIRT1376160	hsa-miR-520d-5p	CLIP-seq
MIRT1376161	hsa-miR-524-5p	CLIP-seq
MIRT1376162	hsa-miR-548a-3p	CLIP-seq
MIRT1376163	hsa-miR-548aa	CLIP-seq
MIRT1376164	hsa-miR-548e	CLIP-seq
MIRT1376165	hsa-miR-548f	CLIP-seq
MIRT1376166	hsa-miR-548o	CLIP-seq
MIRT1376167	hsa-miR-590-3p	CLIP-seq
MIRT1376168	hsa-miR-939	CLIP-seq
MIRT1376125	hsa-miR-103a	CLIP-seq
MIRT1376126	hsa-miR-107	CLIP-seq
MIRT1376131	hsa-miR-15a	CLIP-seq
MIRT1376132	hsa-miR-15b	CLIP-seq
MIRT1376133	hsa-miR-16	CLIP-seq
MIRT1376134	hsa-miR-195	CLIP-seq
MIRT1376135	hsa-miR-1976	CLIP-seq
MIRT1376148	hsa-miR-424	CLIP-seq
MIRT1376152	hsa-miR-4695-3p	CLIP-seq
MIRT1376159	hsa-miR-497	CLIP-seq
MIRT1376125	hsa-miR-103a	CLIP-seq
MIRT1376126	hsa-miR-107	CLIP-seq
MIRT1376131	hsa-miR-15a	CLIP-seq
MIRT1376132	hsa-miR-15b	CLIP-seq
MIRT1376133	hsa-miR-16	CLIP-seq
MIRT1376134	hsa-miR-195	CLIP-seq
MIRT1376135	hsa-miR-1976	CLIP-seq
MIRT1376136	hsa-miR-217	CLIP-seq
MIRT1376148	hsa-miR-424	CLIP-seq
MIRT1376149	hsa-miR-4299	CLIP-seq
MIRT1376152	hsa-miR-4695-3p	CLIP-seq
MIRT1376158	hsa-miR-4797-3p	CLIP-seq
MIRT1376159	hsa-miR-497	CLIP-seq
MIRT1376125	hsa-miR-103a	CLIP-seq
MIRT1376126	hsa-miR-107	CLIP-seq
MIRT1376127	hsa-miR-1197	CLIP-seq
MIRT1376128	hsa-miR-1264	CLIP-seq
MIRT1376130	hsa-miR-1323	CLIP-seq
MIRT1376131	hsa-miR-15a	CLIP-seq
MIRT1376132	hsa-miR-15b	CLIP-seq
MIRT1376133	hsa-miR-16	CLIP-seq
MIRT1376134	hsa-miR-195	CLIP-seq
MIRT1376135	hsa-miR-1976	CLIP-seq
MIRT1376144	hsa-miR-3163	CLIP-seq
MIRT1376146	hsa-miR-376a	CLIP-seq
MIRT1376147	hsa-miR-376b	CLIP-seq
MIRT1376148	hsa-miR-424	CLIP-seq
MIRT1376149	hsa-miR-4299	CLIP-seq
MIRT1376152	hsa-miR-4695-3p	CLIP-seq
MIRT1376154	hsa-miR-4728-3p	CLIP-seq
MIRT1376155	hsa-miR-4753-3p	CLIP-seq
MIRT1376157	hsa-miR-4773	CLIP-seq
MIRT1376158	hsa-miR-4797-3p	CLIP-seq
MIRT1376159	hsa-miR-497	CLIP-seq
MIRT1376166	hsa-miR-548o	CLIP-seq
MIRT1376168	hsa-miR-939	CLIP-seq
MIRT1376128	hsa-miR-1264	CLIP-seq
MIRT1376154	hsa-miR-4728-3p	CLIP-seq
MIRT1376168	hsa-miR-939	CLIP-seq
MIRT1376125	hsa-miR-103a	CLIP-seq
MIRT1376126	hsa-miR-107	CLIP-seq
MIRT1376127	hsa-miR-1197	CLIP-seq
MIRT1376128	hsa-miR-1264	CLIP-seq
MIRT1376129	hsa-miR-129-5p	CLIP-seq
MIRT1376130	hsa-miR-1323	CLIP-seq
MIRT1376131	hsa-miR-15a	CLIP-seq
MIRT1376132	hsa-miR-15b	CLIP-seq
MIRT1376133	hsa-miR-16	CLIP-seq
MIRT1376134	hsa-miR-195	CLIP-seq
MIRT1376136	hsa-miR-217	CLIP-seq
MIRT1376138	hsa-miR-2355-3p	CLIP-seq
MIRT1376139	hsa-miR-23a	CLIP-seq
MIRT1376140	hsa-miR-23b	CLIP-seq
MIRT1376141	hsa-miR-23c	CLIP-seq
MIRT1376143	hsa-miR-3156-3p	CLIP-seq
MIRT1376145	hsa-miR-323b-3p	CLIP-seq
MIRT2629167	hsa-miR-338-5p	CLIP-seq
MIRT1376146	hsa-miR-376a	CLIP-seq
MIRT1376147	hsa-miR-376b	CLIP-seq
MIRT1376148	hsa-miR-424	CLIP-seq
MIRT1376150	hsa-miR-4301	CLIP-seq
MIRT1376151	hsa-miR-4646-3p	CLIP-seq
MIRT2629168	hsa-miR-4666-3p	CLIP-seq
MIRT1376153	hsa-miR-4713-5p	CLIP-seq
MIRT1376154	hsa-miR-4728-3p	CLIP-seq
MIRT1376155	hsa-miR-4753-3p	CLIP-seq
MIRT2629169	hsa-miR-4753-5p	CLIP-seq
MIRT1376158	hsa-miR-4797-3p	CLIP-seq
MIRT1376159	hsa-miR-497	CLIP-seq
MIRT2629170	hsa-miR-5096	CLIP-seq
MIRT1376160	hsa-miR-520d-5p	CLIP-seq
MIRT1376161	hsa-miR-524-5p	CLIP-seq
MIRT1376162	hsa-miR-548a-3p	CLIP-seq
MIRT1376164	hsa-miR-548e	CLIP-seq
MIRT1376165	hsa-miR-548f	CLIP-seq
MIRT1376166	hsa-miR-548o	CLIP-seq
MIRT1376167	hsa-miR-590-3p	CLIP-seq
MIRT1376168	hsa-miR-939	CLIP-seq
MIRT1376125	hsa-miR-103a	CLIP-seq
MIRT1376126	hsa-miR-107	CLIP-seq
MIRT1376127	hsa-miR-1197	CLIP-seq
MIRT1376128	hsa-miR-1264	CLIP-seq
MIRT1376129	hsa-miR-129-5p	CLIP-seq
MIRT1376130	hsa-miR-1323	CLIP-seq
MIRT1376131	hsa-miR-15a	CLIP-seq
MIRT1376132	hsa-miR-15b	CLIP-seq
MIRT1376133	hsa-miR-16	CLIP-seq
MIRT1376134	hsa-miR-195	CLIP-seq
MIRT1376136	hsa-miR-217	CLIP-seq
MIRT1376138	hsa-miR-2355-3p	CLIP-seq
MIRT1376139	hsa-miR-23a	CLIP-seq
MIRT1376140	hsa-miR-23b	CLIP-seq
MIRT1376141	hsa-miR-23c	CLIP-seq
MIRT1376143	hsa-miR-3156-3p	CLIP-seq
MIRT1376145	hsa-miR-323b-3p	CLIP-seq
MIRT2629167	hsa-miR-338-5p	CLIP-seq
MIRT1376146	hsa-miR-376a	CLIP-seq
MIRT1376147	hsa-miR-376b	CLIP-seq
MIRT1376148	hsa-miR-424	CLIP-seq
MIRT1376150	hsa-miR-4301	CLIP-seq
MIRT1376151	hsa-miR-4646-3p	CLIP-seq
MIRT2629168	hsa-miR-4666-3p	CLIP-seq
MIRT1376153	hsa-miR-4713-5p	CLIP-seq
MIRT1376154	hsa-miR-4728-3p	CLIP-seq
MIRT1376155	hsa-miR-4753-3p	CLIP-seq
MIRT2629169	hsa-miR-4753-5p	CLIP-seq
MIRT1376158	hsa-miR-4797-3p	CLIP-seq
MIRT1376159	hsa-miR-497	CLIP-seq
MIRT2629170	hsa-miR-5096	CLIP-seq
MIRT1376160	hsa-miR-520d-5p	CLIP-seq
MIRT1376161	hsa-miR-524-5p	CLIP-seq
MIRT1376162	hsa-miR-548a-3p	CLIP-seq
MIRT1376164	hsa-miR-548e	CLIP-seq
MIRT1376165	hsa-miR-548f	CLIP-seq
MIRT1376166	hsa-miR-548o	CLIP-seq
MIRT1376167	hsa-miR-590-3p	CLIP-seq
MIRT1376168	hsa-miR-939	CLIP-seq

Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000243	Component	Commitment complex	IEA
GO:0000387	Process	Spliceosomal snRNP assembly	IDA	8972845
GO:0000387	Process	Spliceosomal snRNP assembly	IEA
GO:0000395	Process	MRNA 5'-splice site recognition	IBA
GO:0000395	Process	MRNA 5'-splice site recognition	IEA
GO:0000398	Process	MRNA splicing, via spliceosome	IDA	8972845
GO:0000398	Process	MRNA splicing, via spliceosome	IEA
GO:0000398	Process	MRNA splicing, via spliceosome	NAS	33677607
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003723	Function	RNA binding	IEA
GO:0003727	Function	Single-stranded RNA binding	IDA	8798632
GO:0003729	Function	MRNA binding	IEA
GO:0005515	Function	Protein binding	IPI	8076607, 12486009, 17332742, 22365833, 32296183, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	21113136
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005681	Component	Spliceosomal complex	IPI	33677607
GO:0005685	Component	U1 snRNP	IBA
GO:0005685	Component	U1 snRNP	IDA	15312772, 15525645, 21113136
GO:0005685	Component	U1 snRNP	IEA
GO:0005685	Component	U1 snRNP	IPI	33677607
GO:0008270	Function	Zinc ion binding	IDA	15312772
GO:0008270	Function	Zinc ion binding	IEA
GO:0015030	Component	Cajal body	IDA	10068039
GO:0030619	Function	U1 snRNA binding	IDA	1826349
GO:0030627	Function	Pre-mRNA 5'-splice site binding	IBA
GO:0030627	Function	Pre-mRNA 5'-splice site binding	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	8532530
GO:0046872	Function	Metal ion binding	IEA
GO:0071004	Component	U2-type prespliceosome	IEA
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
603522	11157	ENSG00000124562

P09234

Protein name

U1 small nuclear ribonucleoprotein C (U1 snRNP C) (U1-C) (U1C)

Protein function

Component of the spliceosomal U1 snRNP, which is essential for recognition of the pre-mRNA 5' splice-site and the subsequent assembly of the spliceosome. SNRPC/U1-C is directly involved in initial 5' splice-site recognition for both constitutive

PDB

2VRD , 3CW1 , 4PJO , 6ELD , 6QX9 , 7VPX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06220	zf-U1	1 → 38	U1 zinc finger	Domain

Sequence

MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQG
KIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAP
GMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR

Sequence length

159

Interactions

View interactions

	KEGG		Reactome
	Spliceosome		mRNA Splicing - Major Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CELIAC DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONNECTIVE TISSUE DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROINTESTINAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED CONNECTIVE TISSUE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinoma Hepatocellular	Associate	33934562	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Stimulate	34389000	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Associate	34389000	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Associate	27353506	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed Connective Tissue Disease	Associate	27353506	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Stimulate	33934562	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	34793589	★★★★★ ★☆☆☆☆ Found in Text Mining only

SNRPC (small nuclear ribonucleoprotein polypeptide C)