Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6628
Gene name Gene Name - the full gene name approved by the HGNC.
Small nuclear ribonucleoprotein polypeptides B and B1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SNRPB
Synonyms (NCBI Gene) Gene synonyms aliases
CCMS, COD, SNRPB1, Sm-B/B', SmB/B', SmB/SmB', snRNP-B
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20p13
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a ro
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs786201019 C>A,G,T Pathogenic Intron variant
rs786201020 C>A,G Pathogenic Intron variant
rs786201021 G>T Pathogenic Intron variant
rs786201022 G>T Pathogenic 5 prime UTR variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022383 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT045972 hsa-miR-125b-5p CLASH 23622248
MIRT044720 hsa-miR-320a CLASH 23622248
MIRT041541 hsa-miR-193b-3p CLASH 23622248
MIRT508961 hsa-miR-4428 PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000387 Process Spliceosomal snRNP assembly IDA 18984161
GO:0000398 Process MRNA splicing, via spliceosome IBA
GO:0000398 Process MRNA splicing, via spliceosome IC 11991638
GO:0000398 Process MRNA splicing, via spliceosome IDA 28076346, 28781166, 32494006, 36797247
GO:0000398 Process MRNA splicing, via spliceosome NAS 15564372, 30975767, 31744343, 33677607
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
182282 11153 ENSG00000125835
Protein
UniProt ID P14678
Protein name Small nuclear ribonucleoprotein-associated proteins B and B' (snRNP-B) (Sm protein B/B') (Sm-B/B') (SmB/B')
Protein function Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome (PubMed:11991638, PubMed:18984161, PubMed:19325628, PubMed:25555158, Pu
PDB 1D3B , 3CW1 , 3JCR , 3PGW , 4PJO , 4WZJ , 5MQF , 5O9Z , 5XJC , 5YZG , 5Z56 , 5Z57 , 5Z58 , 6AH0 , 6FF7 , 6ICZ , 6ID0 , 6ID1 , 6QDV , 6QW6 , 6QX9 , 6V4X , 6Y53 , 6Y5Q , 7A5P , 7ABG , 7ABI , 7DVQ , 7EVO , 7QTT , 7VPX , 7W59 , 7W5A , 7W5B , 8C6J , 8CH6 , 8H6E , 8H6J , 8H6K , 8H6L , 8HK1 , 8I0P , 8I0R , 8I0S , 8I0T , 8I0U , 8I0V , 8I0W , 8Q7Q , 8Q7V , 8Q7W
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01423 LSM 7 82 LSM domain Domain
Sequence
MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAE
REEKRVLGLVLLRGENLVSMTV
EGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPM
PQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMG
RGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP
Sequence length 240
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Spliceosome
Systemic lupus erythematosus
  SLBP independent Processing of Histone Pre-mRNAs
snRNP Assembly
mRNA Splicing - Major Pathway
mRNA Splicing - Minor Pathway
RNA Polymerase II Transcription Termination
SLBP Dependent Processing of Replication-Dependent Histone Pre-mRNAs
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Cerebrocostomandibular Syndrome Cerebro-costo-mandibular syndrome rs786201019, rs786201020, rs786201021, rs786201022 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Hepatocellular Carcinoma Hepatocellular carcinoma Overlapping CRISPR screens and HCC expression microarray data, we found 13 clinically relevant targets that are essential for HCC tumor cell growth and were significantly up-regulated in HCC tumors 31022357 CBGDA
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 22876301
Breast Neoplasms Associate 20418484
Carcinoma Hepatocellular Associate 33289700, 38189879
Carcinoma Renal Cell Associate 35617983
Cardiomyopathies Associate 32631246
Esophageal Neoplasms Associate 39287291
Glioblastoma Associate 27287018
Lung Neoplasms Associate 22876301
Mandibular Injuries Associate 25047197
Muscular Atrophy Spinal Associate 11720283