SNCG (synuclein gamma)

Gene

• Entrez ID: 6623
• Gene name: Synuclein gamma
• Gene symbol: SNCG
• Synonyms (NCBI Gene): BCSG1, SR
• Chromosome: 10
• Chromosome location: 10q23.2
• Summary: This gene encodes a member of the synuclein family of proteins which are believed to be involved in the pathogenesis of neurodegenerative diseases. Mutations in this gene have also been associated with breast tumor development. [provided by RefSeq, Jan 20

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017445	hsa-miR-335-5p	Microarray	18185580
MIRT054595	hsa-miR-4437	Luciferase reporter assay, qRT-PCR, Western blot	24040069
MIRT054596	hsa-miR-4674	Luciferase reporter assay, qRT-PCR, Western blot	24040069
MIRT054597	hsa-miR-4722-5p	Luciferase reporter assay, qRT-PCR, Western blot	24040069
MIRT054598	hsa-miR-107	Luciferase reporter assay, qRT-PCR, Western blot	24040069
MIRT054599	hsa-miR-103a-3p	Luciferase reporter assay, qRT-PCR, Western blot	24040069
MIRT054599	hsa-miR-103a-3p	PAR-CLIP	26701625
MIRT054599	hsa-miR-103a-3p	PAR-CLIP	26701625
MIRT054599	hsa-miR-103a-3p	PAR-CLIP	26701625
MIRT054599	hsa-miR-103a-3p	PAR-CLIP	26701625
MIRT054599	hsa-miR-103a-3p	PAR-CLIP	26701625
MIRT054599	hsa-miR-103a-3p	PAR-CLIP	26701625
MIRT054599	hsa-miR-103a-3p	PAR-CLIP	26701625
MIRT054599	hsa-miR-103a-3p	PAR-CLIP	26701625
MIRT054598	hsa-miR-107	PAR-CLIP	26701625
MIRT054598	hsa-miR-107	PAR-CLIP	26701625
MIRT054598	hsa-miR-107	PAR-CLIP	26701625
MIRT054598	hsa-miR-107	PAR-CLIP	26701625
MIRT054598	hsa-miR-107	PAR-CLIP	26701625
MIRT054598	hsa-miR-107	PAR-CLIP	26701625
MIRT054598	hsa-miR-107	PAR-CLIP	26701625
MIRT054598	hsa-miR-107	PAR-CLIP	26701625
MIRT2394915	hsa-miR-103a	CLIP-seq
MIRT2394916	hsa-miR-1294	CLIP-seq
MIRT2394917	hsa-miR-3944-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21044950
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	17222866
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005813	Component	Centrosome	IDA
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0008344	Process	Adult locomotory behavior	IEA
GO:0009306	Process	Protein secretion	IEA
GO:0014059	Process	Regulation of dopamine secretion	IEA
GO:0030424	Component	Axon	IEA
GO:0043025	Component	Neuronal cell body	IBA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043679	Component	Axon terminus	IBA
GO:0046928	Process	Regulation of neurotransmitter secretion	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048488	Process	Synaptic vesicle endocytosis	IBA
GO:0050808	Process	Synapse organization	IBA
GO:0050808	Process	Synapse organization	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:1903136	Function	Cuprous ion binding	IBA

Other IDs

• MIM: 602998
• HGNC: 11141
• e!Ensembl: ENSG00000173267

Protein

• UniProt ID: O76070
• Protein name: Gamma-synuclein (Breast cancer-specific gene 1 protein) (Persyn) (Synoretin) (SR)
• Protein function: Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases (By similarity). May
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01387	Synuclein	1 → 126	Synuclein	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in brain, particularly in the substantia nigra. Also expressed in the corpus callosum, heart, skeletal muscle, ovary, testis, colon and spleen. Weak expression in pancreas, kidney and lung.
• Sequence:

  MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTK
  EQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAE
  EAQSGGD

• Sequence length: 127