Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6622
Gene name Gene Name - the full gene name approved by the HGNC.	Synuclein alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SNCA
Synonyms (NCBI Gene) Gene synonyms aliases	NACP, PARK1, PARK4, PD1
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4q22.1
Summary Summary of gene provided in NCBI Entrez Gene.	Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynapti

Show/Hide all(5)

SNP ID	Visualize variation	Clinical significance	Consequence
rs104893875	C>T	Pathogenic	Missense variant, non coding transcript variant, genic upstream transcript variant, coding sequence variant
rs104893877	C>T	Pathogenic	Missense variant, non coding transcript variant, genic upstream transcript variant, coding sequence variant
rs144758871	C>T	Conflicting-interpretations-of-pathogenicity	Synonymous variant, genic upstream transcript variant, non coding transcript variant, coding sequence variant
rs201106962	A>C	Pathogenic, uncertain-significance	Coding sequence variant, genic upstream transcript variant, non coding transcript variant, missense variant
rs431905511	C>T	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant, genic upstream transcript variant

Show/Hide all(42)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000032	hsa-miR-7-5p	qRT-PCR, Luciferase reporter assay, Western blot	19628698
MIRT000032	hsa-miR-7-5p	Luciferase reporter assay	19628698
MIRT000032	hsa-miR-7-5p	Immunocytochemistry, Luciferase reporter assay, qRT-PCR, Western blot	20106983
MIRT004733	hsa-miR-153-3p	Immunocytochemistry, Luciferase reporter assay, qRT-PCR, Western blot	20106983
MIRT054335	mmu-miR-153-3p	Luciferase reporter assay, qRT-PCR, Western blot	23595248
MIRT1375401	hsa-miR-1279	CLIP-seq
MIRT1375402	hsa-miR-3074-5p	CLIP-seq
MIRT1375403	hsa-miR-3607-3p	CLIP-seq
MIRT1375404	hsa-miR-3910	CLIP-seq
MIRT1375405	hsa-miR-3915	CLIP-seq
MIRT1375406	hsa-miR-3928	CLIP-seq
MIRT1375407	hsa-miR-4261	CLIP-seq
MIRT1375408	hsa-miR-4447	CLIP-seq
MIRT1375409	hsa-miR-4472	CLIP-seq
MIRT1375410	hsa-miR-4481	CLIP-seq
MIRT1375411	hsa-miR-4484	CLIP-seq
MIRT1375412	hsa-miR-4488	CLIP-seq
MIRT1375413	hsa-miR-4496	CLIP-seq
MIRT1375414	hsa-miR-4663	CLIP-seq
MIRT1375415	hsa-miR-4697-5p	CLIP-seq
MIRT1375416	hsa-miR-4728-3p	CLIP-seq
MIRT1375417	hsa-miR-4736	CLIP-seq
MIRT1375418	hsa-miR-4745-5p	CLIP-seq
MIRT1375419	hsa-miR-4758-5p	CLIP-seq
MIRT1375420	hsa-miR-486-3p	CLIP-seq
MIRT1375421	hsa-miR-486-5p	CLIP-seq
MIRT1375422	hsa-miR-494	CLIP-seq
MIRT1375423	hsa-miR-548an	CLIP-seq
MIRT2334796	hsa-miR-3614-5p	CLIP-seq
MIRT2334797	hsa-miR-421	CLIP-seq
MIRT2334798	hsa-miR-4286	CLIP-seq
MIRT2334799	hsa-miR-4691-5p	CLIP-seq
MIRT2691601	hsa-miR-1236	CLIP-seq
MIRT2691602	hsa-miR-1244	CLIP-seq
MIRT2691603	hsa-miR-1301	CLIP-seq
MIRT2691604	hsa-miR-3137	CLIP-seq
MIRT2691605	hsa-miR-3664-5p	CLIP-seq
MIRT2691606	hsa-miR-4474-5p	CLIP-seq
MIRT2691607	hsa-miR-4643	CLIP-seq
MIRT2691608	hsa-miR-4660	CLIP-seq
MIRT2691609	hsa-miR-5047	CLIP-seq
MIRT2691610	hsa-miR-642b	CLIP-seq

Show/Hide all(188)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	24252804
GO:0000149	Function	SNARE binding	IDA	20798282
GO:0000287	Function	Magnesium ion binding	IDA	11850416
GO:0000976	Function	Transcription cis-regulatory region binding	TAS	24252804
GO:0001774	Process	Microglial cell activation	IEA
GO:0001774	Process	Microglial cell activation	TAS	24252804
GO:0001921	Process	Positive regulation of receptor recycling	IDA	18980610
GO:0001956	Process	Positive regulation of neurotransmitter secretion	IEA
GO:0001963	Process	Synaptic transmission, dopaminergic	IEA
GO:0003779	Function	Actin binding	IPI	18331289
GO:0004857	Function	Enzyme inhibitor activity	IDA	11943812
GO:0004860	Function	Protein kinase inhibitor activity	TAS	30194957
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IDA	10818098
GO:0005504	Function	Fatty acid binding	IDA	16687662
GO:0005507	Function	Copper ion binding	IDA	21319811, 21320589
GO:0005509	Function	Calcium ion binding	IDA	11312271, 11850416
GO:0005515	Function	Protein binding	IPI	10319874, 11943812, 11956199, 12044636, 12059041, 12958153, 15207266, 15590652, 15671022, 16595633, 16882008, 17027006, 17156375, 18331289, 19549071, 19762560, 20798282, 21320589, 21798244, 21985244, 22119730, 22163275, 22854022, 23183827, 24412932, 24895406, 25241761, 26643113, 269
GO:0005543	Function	Phospholipid binding	IDA	17222866
GO:0005543	Function	Phospholipid binding	IEA
GO:0005576	Component	Extracellular region	IDA	15863497
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	24936070
GO:0005634	Component	Nucleus	IDA	12406186, 16959795, 17408955, 24936070
GO:0005634	Component	Nucleus	IEA
GO:0005640	Component	Nuclear outer membrane	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	12406186, 12958153, 15863497, 16959795, 17408955, 23983262, 24403142, 25561023
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	TAS	24252804
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005764	Component	Lysosome	TAS	24477431
GO:0005829	Component	Cytosol	IDA	8248242, 24936070, 31034892
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005840	Component	Ribosome	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA	12958153, 15641770, 17222866
GO:0005886	Component	Plasma membrane	IEA
GO:0005938	Component	Cell cortex	IDA	19157893
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006638	Process	Neutral lipid metabolic process	IEA
GO:0006644	Process	Phospholipid metabolic process	IEA
GO:0006749	Process	Glutathione metabolic process	IDA	23507046
GO:0007006	Process	Mitochondrial membrane organization	IEA
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0007269	Process	Neurotransmitter secretion	IEA
GO:0008017	Function	Microtubule binding	IEA
GO:0008021	Component	Synaptic vesicle	IEA
GO:0008047	Function	Enzyme activator activity	IDA	23507046
GO:0008198	Function	Ferrous iron binding	IDA	11850416
GO:0008270	Function	Zinc ion binding	IDA	11850416
GO:0008289	Function	Lipid binding	EXP	11286556, 20524659, 22315227
GO:0008289	Function	Lipid binding	IDA	8901511
GO:0008344	Process	Adult locomotory behavior	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010040	Process	Response to iron(II) ion	IDA	11850416
GO:0010642	Process	Negative regulation of platelet-derived growth factor receptor signaling pathway	IDA	12239163
GO:0014048	Process	Regulation of glutamate secretion	IEA
GO:0014059	Process	Regulation of dopamine secretion	IEA
GO:0014059	Process	Regulation of dopamine secretion	IEA
GO:0014059	Process	Regulation of dopamine secretion	TAS	21320589
GO:0015629	Component	Actin cytoskeleton	IDA	17408955
GO:0016020	Component	Membrane	IDA	24936070
GO:0016020	Component	Membrane	IEA
GO:0016079	Process	Synaptic vesicle exocytosis	IDA	28288128
GO:0016082	Process	Synaptic vesicle priming	IMP	30404828
GO:0016234	Component	Inclusion body	IDA	17222866, 20039155
GO:0016234	Component	Inclusion body	IEA
GO:0016491	Function	Oxidoreductase activity	IDA	21320589
GO:0019894	Function	Kinesin binding	IPI	16176937
GO:0019899	Function	Enzyme binding	IEA
GO:0019899	Function	Enzyme binding	IPI	23507046
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030424	Component	Axon	IDA	12958153
GO:0030424	Component	Axon	IEA
GO:0030426	Component	Growth cone	IDA	12958153
GO:0030426	Component	Growth cone	IEA
GO:0030544	Function	Hsp70 protein binding	IPI	18975920
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0031092	Component	Platelet alpha granule membrane	IDA	12239163
GO:0031115	Process	Negative regulation of microtubule polymerization	IDA	21127069
GO:0031623	Process	Receptor internalization	IDA	18980610
GO:0031648	Process	Protein destabilization	IDA	21320589
GO:0032026	Process	Response to magnesium ion	IDA	11850416
GO:0032496	Process	Response to lipopolysaccharide	IDA	12406186
GO:0032991	Component	Protein-containing complex	IMP	31034892
GO:0034341	Process	Response to type II interferon	IDA	19157893
GO:0034599	Process	Cellular response to oxidative stress	IDA	23507046
GO:0034599	Process	Cellular response to oxidative stress	IEA
GO:0035493	Process	SNARE complex assembly	IDA	20798282
GO:0035493	Process	SNARE complex assembly	IEA
GO:0035543	Process	Positive regulation of SNARE complex assembly	IDA	20798282
GO:0040012	Process	Regulation of locomotion	IEA
GO:0042220	Process	Response to cocaine	IEA
GO:0042393	Function	Histone binding	IDA	16959795
GO:0042393	Function	Histone binding	IEA
GO:0042416	Process	Dopamine biosynthetic process	IEA
GO:0042416	Process	Dopamine biosynthetic process	TAS	21320589
GO:0042417	Process	Dopamine metabolic process	IEA
GO:0042775	Process	Mitochondrial ATP synthesis coupled electron transport	IEA
GO:0042802	Function	Identical protein binding	IDA	24936070, 25561023
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	15502874, 16330551, 16764865, 18550842, 18614564, 19745811, 19875982, 21358815, 21443877, 22119730, 22854022, 23927048, 24374342, 24895406, 24983211, 25643172, 25732184, 27018801, 31270237, 31695184, 32461689, 34860005
GO:0042995	Component	Cell projection	IEA
GO:0043014	Function	Alpha-tubulin binding	IPI	11698390
GO:0043025	Component	Neuronal cell body	IBA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043030	Process	Regulation of macrophage activation	IEA
GO:0043065	Process	Positive regulation of apoptotic process	TAS	24252804
GO:0043066	Process	Negative regulation of apoptotic process	IMP	10818098
GO:0043195	Component	Terminal bouton	IEA
GO:0043274	Function	Phospholipase binding	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043679	Component	Axon terminus	IBA
GO:0043679	Component	Axon terminus	IEA
GO:0044344	Process	Cellular response to fibroblast growth factor stimulus	IEA
GO:0045202	Component	Synapse	IEA
GO:0045807	Process	Positive regulation of endocytosis	IDA	18980610
GO:0045920	Process	Negative regulation of exocytosis	IMP	12239163
GO:0045921	Process	Positive regulation of exocytosis	IMP	30404828
GO:0045963	Process	Negative regulation of dopamine metabolic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046928	Process	Regulation of neurotransmitter secretion	IEA
GO:0048148	Process	Behavioral response to cocaine	IEA
GO:0048156	Function	Tau protein binding	IDA	17408955, 21127069
GO:0048168	Process	Regulation of neuronal synaptic plasticity	IEA
GO:0048169	Process	Regulation of long-term neuronal synaptic plasticity	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	20039155
GO:0048487	Function	Beta-tubulin binding	IEA
GO:0048488	Process	Synaptic vesicle endocytosis	IBA
GO:0048488	Process	Synaptic vesicle endocytosis	IEA
GO:0048488	Process	Synaptic vesicle endocytosis	ISS
GO:0048489	Process	Synaptic vesicle transport	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IDA	25533483
GO:0050806	Process	Positive regulation of synaptic transmission	IEA
GO:0050808	Process	Synapse organization	IBA
GO:0050808	Process	Synapse organization	IEA
GO:0050812	Process	Regulation of acyl-CoA biosynthetic process	IEA
GO:0051219	Function	Phosphoprotein binding	IDA	21127069
GO:0051259	Process	Protein complex oligomerization	IEA
GO:0051262	Process	Protein tetramerization	IDA	21841800
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IDA	15641770
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051583	Process	Dopamine uptake involved in synaptic transmission	TAS	21320589
GO:0051585	Process	Negative regulation of dopamine uptake involved in synaptic transmission	IDA	12958153
GO:0051612	Process	Negative regulation of serotonin uptake	IDA	16882008
GO:0051621	Process	Regulation of norepinephrine uptake	IGI	18331289
GO:0051622	Process	Negative regulation of norepinephrine uptake	IDA	17156375
GO:0055074	Process	Calcium ion homeostasis	IDA	12239163
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0060090	Function	Molecular adaptor activity	EXP	11286556
GO:0060291	Process	Long-term synaptic potentiation	IEA
GO:0060732	Process	Positive regulation of inositol phosphate biosynthetic process	IDA	15641770
GO:0060961	Function	Phospholipase D inhibitor activity	IDA	19146388
GO:0061024	Process	Membrane organization	IEA
GO:0070495	Process	Negative regulation of thrombin-activated receptor signaling pathway	IDA	12239163
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IEA
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	ISS
GO:0070555	Process	Response to interleukin-1	IDA	12406186
GO:0070840	Function	Dynein complex binding	IPI	16176937
GO:0071280	Process	Cellular response to copper ion	IDA	21320589
GO:0071872	Process	Cellular response to epinephrine stimulus	TAS	21320589
GO:0097435	Process	Supramolecular fiber organization	TAS	21320589
GO:0098793	Component	Presynapse	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0099512	Component	Supramolecular fiber	IDA	17222866, 18346205, 23507046
GO:0140311	Function	Protein sequestering activity	IDA	23507046
GO:0141108	Function	Transporter regulator activity	IGI	18331289
GO:1902957	Process	Negative regulation of mitochondrial electron transport, NADH to ubiquinone	TAS	24252804
GO:1903136	Function	Cuprous ion binding	IBA
GO:1903136	Function	Cuprous ion binding	IEA
GO:1903136	Function	Cuprous ion binding	IMP	25495902
GO:1903285	Process	Positive regulation of hydrogen peroxide catabolic process	IDA	23507046
GO:1903421	Process	Regulation of synaptic vesicle recycling	TAS	23983262
GO:1903426	Process	Regulation of reactive oxygen species biosynthetic process	TAS	24252804
GO:1904307	Process	Response to desipramine	IEA
GO:1904377	Process	Positive regulation of protein localization to cell periphery	IGI	25533483
GO:1904715	Process	Negative regulation of chaperone-mediated autophagy	IMP	20697033
GO:1905606	Process	Regulation of presynapse assembly	IGI	25533483
GO:1990000	Process	Amyloid fibril formation	EXP	8901511
GO:2000377	Process	Regulation of reactive oxygen species metabolic process	IEA

MIM	HGNC	e!Ensembl
163890	11138	ENSG00000145335

Protein

UniProt ID

P37840

Protein name

Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)

Protein function

Neuronal protein that plays several roles in synaptic activity such as regulation of synaptic vesicle trafficking and subsequent neurotransmitter release (PubMed:20798282, PubMed:26442590, PubMed:28288128, PubMed:30404828). Participates as a mon

PDB

1XQ8 , 2JN5 , 2KKW , 2M55 , 2N0A , 2X6M , 3Q25 , 3Q26 , 3Q27 , 3Q28 , 3Q29 , 4BXL , 4R0U , 4R0W , 4RIK , 4RIL , 4ZNN , 5CRW , 6A6B , 6CT7 , 6CU7 , 6CU8 , 6H6B , 6I42 , 6L1T , 6L1U , 6L4S , 6LRQ , 6OSJ , 6OSL , 6OSM , 6PEO , 6PES , 6RT0 , 6RTB , 6SST , 6SSX , 6UFR , 6XYO , 6XYP , 6XYQ , 7C1D , 7E0F , 7L7H , 7LC9 , 7NCA , 7NCG , 7NCH , 7NCI , 7NCJ , 7NCK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01387	Synuclein	1 → 131	Synuclein	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in presynaptic terminals in the central nervous system. Expressed principally in brain. {ECO:0000269|PubMed:8194594}.

Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP
DNEAYEMPSEEGYQDYEPEA

Sequence length

140

Interactions

View interactions

	KEGG		Reactome
	Alzheimer disease Parkinson disease Pathways of neurodegeneration - multiple diseases		Amyloid fiber formation

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Parkinson disease	Autosomal dominant Parkinson disease 1, Autosomal dominant Parkinson disease 4	rs104893877, rs104893878, rs431905511	N/A

Show/Hide Unknown Diseases (7)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Anxiety Disorder	Anxiety	N/A	N/A	GWAS
Dementia	Lewy body dementia	N/A	N/A	GenCC
Diabetes	Type 2 diabetes with ketoacidosis (PheCode 250.21)	N/A	N/A	GWAS
Insomnia	Insomnia	N/A	N/A	GWAS
Neuroticism	Neuroticism	N/A	N/A	GWAS
Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (233)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
AA amyloidosis	Associate	20026050, 20132485, 22067166, 23349712, 27288043, 27352802, 29959225, 31424918, 31695369, 32170541, 32453478, 32457390, 32709107, 32868414, 35283247 View all (6 more)
Abnormalities Drug Induced	Associate	12684441, 35648061
Acute cholinergic dysautonomia	Associate	35563582
Adenocarcinoma of Lung	Associate	32559455, 35421944
Adenoma	Associate	21777459
Akinetic Mutism	Associate	39256877
Alcoholism	Associate	19196539, 32432761
Alternating hemiplegia of childhood	Associate	26323479
Alzheimer Disease	Associate	10407019, 10619569, 15912881, 16825955, 17761424, 19722699, 20024519, 20448034, 21056999, 21613474, 22701727, 23308173, 23603399, 24586351, 24729344 View all (24 more)
Alzheimer Disease	Stimulate	30477568, 36142742
Alzheimer Disease	Inhibit	38256230
Alzheimer Disease 15	Associate	18661559
Amyloid Neuropathies Familial	Associate	12900507
Amyotrophic lateral sclerosis 1	Associate	26208350
Aortic Valve Insufficiency	Associate	38517804
Aphasia	Associate	19632874
Ataxia	Associate	21601954
Atrial Fibrillation	Associate	35138035
Atrophy	Associate	29868450, 39863324
Attention Deficit and Disruptive Behavior Disorders	Stimulate	31847878
Attention Deficit and Disruptive Behavior Disorders	Associate	35213388
Autism Spectrum Disorder	Associate	32807774
Autonomic Nervous System Diseases	Associate	17291816, 18571778
Basal Ganglia Diseases	Associate	29991596
Blood Coagulation Disorders	Associate	35346107
Body Weight	Associate	20074637, 21795716, 22776646, 23349712, 24018986, 25212463, 27445146, 27888296, 28395086, 29243911
Brain Concussion	Associate	27478013, 36403906
Brain Diseases	Associate	11588178, 19632874, 26208350, 32707907, 33955002, 36737438
Brain Injuries Traumatic	Stimulate	21124000
Brain Injuries Traumatic	Associate	27478013
Brain Neoplasms	Associate	17189270
Brain Stem Neoplasms	Associate	30472757, 30639209
Breast Neoplasms	Associate	27081041, 35040589
Budd Chiari Syndrome	Associate	28983615
Calcinosis Cutis	Associate	21448452
Caliciviridae Infections	Stimulate	28866688
Carcinogenesis	Associate	35346107, 35421944
Carcinoma Hepatocellular	Associate	32148378
Carcinoma Lewis Lung	Associate	18366718, 20619503, 22326202, 30472757
Carcinoma Non Small Cell Lung	Associate	26245297
Carcinoma Pancreatic Ductal	Associate	35409135
Carcinoma Renal Cell	Stimulate	25390032
Cardiomyopathy Dilated	Associate	40332088
Cardiovascular Diseases	Associate	32739154
Central Nervous System Infections	Associate	22178859, 34846537
Cerebellar Ataxia	Associate	35997131
Ceroid lipofuscinosis neuronal 5	Stimulate	30655561
Cholesteatoma	Associate	37532176
Cholesteatoma Middle Ear	Associate	37532176
Chromosome Aberrations	Associate	22334684
Chromosome Duplication	Associate	33983072
Chronic Traumatic Encephalopathy	Associate	30563563
Chronobiology Disorders	Associate	33066427
Cocaine Related Disorders	Stimulate	12684441
Cognition Disorders	Associate	19632874, 23603399, 25844871, 26077166, 32002988, 32786148, 33649398, 33983072, 34092653, 35106798, 35179198, 36261424, 39863324, 39888600, 40713844
Cognition Disorders	Inhibit	26220939
Cognition Disorders	Stimulate	35418463
Cognitive Dysfunction	Stimulate	23603399, 30477568, 40318118
Cognitive Dysfunction	Associate	39863324
Colorectal Neoplasms	Associate	21777459, 24362313, 25802477, 34957998
Corticobasal Degeneration	Associate	40135351
COVID 19	Inhibit	37686360
Craniocerebral Trauma	Associate	25370538
Cystic Fibrosis	Associate	31501480
Death	Associate	16959772, 32035284
Delirium	Associate	12684441, 39256877
Dementia	Associate	10619569, 18389263, 18571778, 20599975, 21264917, 21863007, 22178859, 26306801, 27091628, 28395086, 28399184, 32002988, 32291284, 33300824, 33983072 View all (5 more)
Demyelinating Diseases	Associate	25358962
Depressive Disorder	Associate	26077166, 33082300
Diabetes Mellitus Type 1	Associate	33832546
Diabetes Mellitus Type 2	Associate	34882862
Diabetes Mellitus Type 2	Inhibit	38256230
Diffuse Neurofibrillary Tangles with Calcification	Associate	21613474, 32568358, 35729600
DiGeorge Syndrome	Associate	24018986
Disease	Associate	21953863, 26306801, 26506339, 40618170, 9801138
Disruptive Impulse Control and Conduct Disorders	Associate	39334114
DNA Virus Infections	Associate	30977294
Down Syndrome	Associate	16959772
Drug Related Side Effects and Adverse Reactions	Associate	10407019, 10934254, 12145295, 14627698, 16567160, 17215369, 17712623, 18258594, 18382667, 18390556, 18508479, 19558452, 20041693, 20141569, 20334701 View all (56 more)
Drug Related Side Effects and Adverse Reactions	Stimulate	14742448, 17391701, 17900533, 19141614, 22528838, 22920859, 23594135, 23710708, 24989254, 30562735, 34948195, 36464107, 39684444
Dystonia 12	Associate	26323479
Dystonic Disorders	Associate	20074637
Endocrine System Diseases	Associate	35648061
Epilepsy Temporal Lobe	Associate	18389263
Fabry Disease	Associate	37014703
Fatigue	Associate	23022913
Fever	Associate	12684441
Fever	Inhibit	40724923
Fractures Spontaneous	Associate	18661559, 23744071, 30472757, 35328814, 39617169
Frontotemporal Dementia	Associate	25003242, 32786148, 33771571, 40713844
Frontotemporal Lobar Degeneration	Associate	17522386, 21607722, 25962793, 32786148, 40135351
Gastrointestinal Diseases	Associate	28866688
Gaucher Disease	Associate	21653695, 21742527, 24070323, 29481565, 31669751, 33672048, 34213307, 37189391
Gaucher Disease	Stimulate	27413154, 33342090, 40399377
Genetic Diseases Inborn	Associate	20127702, 38154385, 9634534
Genetic Diseases Inborn	Stimulate	22757585
Glomerulonephritis Membranous	Associate	29242346
Glut1 Deficiency Syndrome	Stimulate	39847894
Glutathione Peroxidase Deficiency Hemolytic Anemia possibly due to	Associate	29466944
Hallucinations	Associate	26306801, 39256877, 39888600, 40200913
Heart Diseases	Associate	28399184
Heredodegenerative Disorders Nervous System	Associate	22912757, 35648061, 40106490
HIV Infections	Stimulate	19115126
Huntington Disease	Associate	22119730
Hydrocephalus Normal Pressure	Associate	40200913
Hyperglycemia	Stimulate	40221968
Hyperglycemic Hyperosmolar Nonketotic Coma	Stimulate	39847894
Hypothermia	Associate	21124000
Infantile Epileptic Dyskinetic Encephalopathy	Associate	27597757
Infections	Associate	28866688
Infections	Stimulate	37686360
Inflammation	Associate	20448034, 21767974, 22178859, 23022913, 31253822, 32035284, 32041265, 34333522, 35325812, 36130498, 37532176, 38062843, 39511366, 40702763
Inflammation	Stimulate	28866688
Insulin Resistance	Associate	29092095, 33832546
Intestinal Diseases	Stimulate	28866688
Juvenile osteoporosis	Associate	29750314
Leukemia Erythroblastic Acute	Associate	21264917
Leukemia Megakaryoblastic Acute	Associate	21264917
Leukemia Myeloid Acute	Associate	21264917, 34555853
Leukodystrophy Globoid Cell	Associate	29481565, 34999780
Lewy Body Disease	Associate	10391881, 10407019, 10766891, 10915790, 10934254, 11331421, 11438481, 11560921, 11734199, 11744721, 11850416, 11893734, 12213717, 12661766, 12684441 View all (183 more)
Lewy Body Disease	Inhibit	20024519, 34983390
Lewy Body Disease	Stimulate	31733655, 32879386
limbic predominant age related TDP 43 encephalopathy	Associate	34854996
Liver Neoplasms	Associate	32148378
Lung Neoplasms	Associate	32559455
Lupus Erythematosus Systemic	Associate	22835828, 24874737
Lymphoma	Associate	24362313
Lymphoma Non Hodgkin	Associate	24362313
Lysosomal Storage Diseases	Associate	22803570, 27445146, 28487947, 29860491, 31669185, 36233303, 37252975, 40106490
Malformations of Cortical Development	Associate	19632874
Malformations of Cortical Development Group I	Associate	36674945
Medulloblastoma	Associate	29369502
Melanoma	Associate	20463956, 23028833, 25333933, 32868414, 37286800, 38189631, 39222576, 39511366
Melanoma Cutaneous Malignant	Stimulate	38189631
Mental Disorders	Associate	26077166, 28416701, 36261424, 39256877
Microphthalmia Isolated 1	Associate	31976583
Mitochondrial complex I deficiency	Inhibit	18245082
Mitochondrial Diseases	Associate	21124000, 23804100, 23934919, 24120997, 27866262, 28698628, 28990084, 29899557, 31727879, 31760463, 32359427, 34572052, 34625559, 35175558, 36179692 View all (4 more)
Mitochondrial Diseases	Stimulate	32486485, 37178741
Mitochondrial Myopathy with a Defect in Mitochondrial Protein Transport	Associate	28698628
Mitochondrial Myopathy with a Defect in Mitochondrial Protein Transport	Stimulate	28698628
Motor Disorders	Associate	34067663, 36261424
Movement Disorders	Associate	12900507, 30957308, 32879386, 33539026
Multiple Myeloma	Associate	12900507
Multiple Sclerosis	Inhibit	37535585
Multiple System Atrophy	Associate	10619569, 10766891, 10915790, 11560921, 11893734, 15028717, 16543523, 17291816, 17712623, 18414880, 19475667, 19722699, 19771175, 20132485, 21601954 View all (49 more)
Muscle Rigidity	Associate	34067663, 40200913
Myelodysplastic Syndromes	Associate	21264917
Myoclonus	Associate	18389263, 39256877
Myopathies Structural Congenital	Associate	40479844
Myopathy with Giant Abnormal Mitochondria	Associate	27866262
Myositis Inclusion Body	Associate	29780824
Myotonic Dystrophy	Associate	33955002
Neointima	Associate	20026050
Neoplasms	Associate	17189270, 21264917, 22806580, 24362313, 26245297, 28410208, 32559455, 33307186, 34957998, 35409135, 35648061
Neoplasms	Inhibit	29369502, 35346107
Neoplasms	Stimulate	29579369
Nerve Degeneration	Associate	12900507, 16606366, 18389263, 18957893, 19141614, 19860837, 21601954, 21795716, 22453917, 24632948, 27191603, 27866262, 28731447, 29242346, 29899557 View all (28 more)
Nerve Degeneration	Stimulate	33730050, 35175558, 36455858
Nervous System Diseases	Associate	17785456, 30472757, 34754035, 36752535
Neuritis	Associate	32429337
Neuroaxonal Dystrophies	Associate	24252552
Neurobehavioral Manifestations	Associate	30477568, 35040589
Neuroblastoma	Associate	10934254, 12716427, 14742448, 21127069, 21848810, 25054189, 25207598, 29242346, 35049152, 37286800, 9862428
Neurodegenerative Diseases	Associate	10075647, 10407019, 10818098, 10952980, 11588178, 11812782, 12239163, 12857790, 12893833, 12900507, 15026413, 16146428, 16464864, 16567160, 16764865 View all (96 more)
Neurodegenerative Diseases	Stimulate	24831002
Neuroinflammatory Diseases	Associate	24593806, 31253822, 32035284, 34333522, 34625559, 36674945, 37408202
Neuroinflammatory Diseases	Stimulate	36130498, 37365181
Neurologic Manifestations	Associate	17893145, 24398657, 26077166, 27478013, 31229470, 31727879, 40479844
Neuronal Ceroid Lipofuscinoses	Stimulate	30655561
Neuronal intestinal pseudoobstruction	Associate	40713844
Neurotoxicity Syndromes	Associate	15615715, 16020550, 16959772, 17391701, 20890676, 21127069, 25985292, 28108469, 28450057, 29054856, 29092095, 30320583, 30562735, 30769283, 31991248 View all (6 more)
Neurotoxicity Syndromes	Stimulate	32429337, 34333522, 36464107, 37731009
Nevus	Associate	20463956
Nevus Pigmented	Associate	20463956
Niemann Pick Disease Type C	Associate	32371106, 40106490
Night blindness congenital stationary	Associate	27685250, 35397003, 36142742, 36380732
Nonsyndromic Holoprosencephaly	Associate	27021906
Olfaction Disorders	Associate	40200913
Olivopontocerebellar Atrophies	Associate	30203094, 35997131
Osteosarcoma	Associate	17189270
Ovarian Neoplasms	Associate	26261572
Pallidopyramidal syndrome	Associate	25003242
Pancreatic Neoplasms	Associate	21448452, 35409135, 37857015
Pantothenate Kinase Associated Neurodegeneration	Associate	17712623
Paranoid Disorders	Associate	12684441
Parkinson Disease	Associate	10075647, 10092675, 10391881, 10407019, 10557341, 10619569, 10639120, 10766891, 10818098, 10915790, 10934254, 10952980, 11080208, 11181819, 11309462 View all (717 more)
Parkinson Disease	Inhibit	17203291, 22019052, 25849645, 26220939, 27021906, 32006615, 34067663, 34285331, 35175558
Parkinson Disease	Stimulate	24477431, 32879386, 35044538, 35362022, 36677744, 36982820, 39684585
Parkinson Disease Familial Type 1	Associate	18211709, 20448034, 25635052, 28282812, 33232556, 37290280
Parkinson Disease Secondary	Associate	15026413, 16020550, 17291816, 18571778, 20127702, 21653695, 21757228, 21953863, 23934919, 24892822, 25003242, 26077166, 26306801, 27091628, 27096366 View all (14 more)
Parkinson Disease Secondary	Stimulate	27413154
Parkinsonian Disorders	Associate	17531291, 18366718, 20445061, 22617348, 22623900, 24656894, 27091628
Pigmentation Disorders	Associate	35805172
Plaque Amyloid	Associate	10407019, 11744721, 12684441, 15193026, 17391701, 18389263, 21056999, 23133543, 23300640, 23744071, 25393002, 26506339, 27226637, 29057912, 29969391, 30805666 View all (1 more)
Plaque Amyloid	Stimulate	10619569
Plexosarcoma	Associate	32921251
Polycystic Ovary Syndrome	Inhibit	38256230
Prion Diseases	Associate	22701727, 27793473, 35288744
Progressive supranuclear palsy atypical	Associate	17675576, 27091628
Proteostasis Deficiencies	Associate	40318118
Psychomotor Agitation	Associate	12684441
Pulmonary Disease Chronic Obstructive	Inhibit	32559455
REM Sleep Behavior Disorder	Associate	26475692, 28843021, 29466944, 31976583, 32444558
Retrograde Degeneration	Associate	28269775, 29991596, 36430645
Rett Syndrome	Associate	38429622
Rosacea	Associate	37437773
Schizophrenia	Associate	32432761
Seizures	Associate	14535945, 39256877
Signs and Symptoms	Associate	22615757
Skin Diseases	Associate	35325812
Sleep Deprivation	Stimulate	24728187
Sleep Deprivation	Associate	24728187, 28698628
Sleep Wake Disorders	Associate	18389263, 26077166
Small Fiber Neuropathy	Associate	34076298
Spastic Paraplegia Hereditary	Associate	26306801, 26506339
Squamous Cell Carcinoma of Head and Neck	Associate	35923111
Striatonigral Degeneration	Associate	31870437, 35997131
succinic semialdehyde dehydrogenase deficiency	Associate	33557678
Supranuclear Palsy Progressive	Associate	17675576, 26506339
Synucleinopathies	Associate	10915790, 12857790, 15912881, 15944382, 16146428, 18957893, 19164293, 20026050, 20433710, 21742527, 22912757, 23404372, 23744071, 24138030, 24204929 View all (54 more)
Synucleinopathies	Inhibit	23308173
Tauopathies	Associate	40713844
Tay Sachs Disease	Associate	40106490
tinea nigra	Associate	34625559
Tooth Loss	Associate	29991596
Tremor	Associate	27021906
Urinary Bladder Neoplasms	Inhibit	35346107
Ventricular Fibrillation	Associate	12900507, 18692132, 19013262, 19596443, 28624352, 32291284
Virus Diseases	Stimulate	28866688
Wolffian tumor	Associate	31976583
Wounds and Injuries	Associate	21124000

SNCA (synuclein alpha)