Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6616
Gene name Gene Name - the full gene name approved by the HGNC.	Synaptosome associated protein 25
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SNAP25
Synonyms (NCBI Gene) Gene synonyms aliases	CMS18, DEE117, RIC-4, RIC4, SEC9, SNAP, SNAP-25, SUP, bA416N4.2, dJ1068F16.2
Disease Acronyms (UniProt) Disease acronyms from UniProt database	CMS18
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20p12.2
Summary Summary of gene provided in NCBI Entrez Gene.	Synaptic vesicle membrane docking and fusion is mediated by SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) located on the vesicle membrane (v-SNAREs) and the target membrane (t-SNAREs). The assembled v-SNARE/t-SNARE comple

Show/Hide all(3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs797044873	G>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1555794286	T>A	Pathogenic	Intron variant, coding sequence variant, missense variant
rs1600807788	G>C	Likely-pathogenic	Coding sequence variant, missense variant

Show/Hide all(326)

miRTarBase ID	miRNA	Experiments	Reference
MIRT438002	hsa-miR-641	Luciferase reporter assay	24391914
MIRT438002	hsa-miR-641	Luciferase reporter assay	24391914
MIRT438002	hsa-miR-641	Luciferase reporter assay	24391914
MIRT438002	hsa-miR-641	Luciferase reporter assay	24391914
MIRT438002	hsa-miR-641	Luciferase reporter assay	24391914
MIRT438002	hsa-miR-641	Luciferase reporter assay	24391914
MIRT438002	hsa-miR-641	Luciferase reporter assay	24391914
MIRT438002	hsa-miR-641	Luciferase reporter assay	24391914
MIRT724621	hsa-miR-6819-3p	HITS-CLIP	19536157
MIRT724620	hsa-miR-6877-3p	HITS-CLIP	19536157
MIRT724619	hsa-miR-194-3p	HITS-CLIP	19536157
MIRT724618	hsa-miR-1825	HITS-CLIP	19536157
MIRT724617	hsa-miR-199a-5p	HITS-CLIP	19536157
MIRT724616	hsa-miR-199b-5p	HITS-CLIP	19536157
MIRT724615	hsa-miR-766-3p	HITS-CLIP	19536157
MIRT724614	hsa-miR-3925-3p	HITS-CLIP	19536157
MIRT724613	hsa-miR-6728-3p	HITS-CLIP	19536157
MIRT724612	hsa-miR-103a-2-5p	HITS-CLIP	19536157
MIRT724611	hsa-miR-3157-5p	HITS-CLIP	19536157
MIRT724610	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT724609	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT497005	hsa-miR-208a-5p	PAR-CLIP	22291592
MIRT497004	hsa-miR-208b-5p	PAR-CLIP	22291592
MIRT497003	hsa-miR-29b-1-5p	PAR-CLIP	22291592
MIRT497002	hsa-miR-4480	PAR-CLIP	22291592
MIRT497001	hsa-miR-19a-5p	PAR-CLIP	22291592
MIRT497000	hsa-miR-19b-1-5p	PAR-CLIP	22291592
MIRT496999	hsa-miR-19b-2-5p	PAR-CLIP	22291592
MIRT496998	hsa-miR-192-3p	PAR-CLIP	22291592
MIRT496997	hsa-miR-4776-3p	PAR-CLIP	22291592
MIRT439576	hsa-miR-136-5p	HITS-CLIP	24374217
MIRT439576	hsa-miR-136-5p	HITS-CLIP	24374217
MIRT724621	hsa-miR-6819-3p	HITS-CLIP	19536157
MIRT724620	hsa-miR-6877-3p	HITS-CLIP	19536157
MIRT724619	hsa-miR-194-3p	HITS-CLIP	19536157
MIRT724618	hsa-miR-1825	HITS-CLIP	19536157
MIRT724617	hsa-miR-199a-5p	HITS-CLIP	19536157
MIRT724616	hsa-miR-199b-5p	HITS-CLIP	19536157
MIRT724615	hsa-miR-766-3p	HITS-CLIP	19536157
MIRT724614	hsa-miR-3925-3p	HITS-CLIP	19536157
MIRT724613	hsa-miR-6728-3p	HITS-CLIP	19536157
MIRT724612	hsa-miR-103a-2-5p	HITS-CLIP	19536157
MIRT724611	hsa-miR-3157-5p	HITS-CLIP	19536157
MIRT724610	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT724609	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT497005	hsa-miR-208a-5p	PAR-CLIP	22291592
MIRT497004	hsa-miR-208b-5p	PAR-CLIP	22291592
MIRT497003	hsa-miR-29b-1-5p	PAR-CLIP	22291592
MIRT497002	hsa-miR-4480	PAR-CLIP	22291592
MIRT497001	hsa-miR-19a-5p	PAR-CLIP	22291592
MIRT497000	hsa-miR-19b-1-5p	PAR-CLIP	22291592
MIRT496999	hsa-miR-19b-2-5p	PAR-CLIP	22291592
MIRT496998	hsa-miR-192-3p	PAR-CLIP	22291592
MIRT496997	hsa-miR-4776-3p	PAR-CLIP	22291592
MIRT1374946	hsa-miR-1252	CLIP-seq
MIRT1374947	hsa-miR-186	CLIP-seq
MIRT1374948	hsa-miR-28-3p	CLIP-seq
MIRT1374949	hsa-miR-28-5p	CLIP-seq
MIRT1374950	hsa-miR-3139	CLIP-seq
MIRT1374951	hsa-miR-3166	CLIP-seq
MIRT1374952	hsa-miR-369-3p	CLIP-seq
MIRT1374953	hsa-miR-3944-5p	CLIP-seq
MIRT1374954	hsa-miR-421	CLIP-seq
MIRT1374955	hsa-miR-4422	CLIP-seq
MIRT1374956	hsa-miR-4633-3p	CLIP-seq
MIRT1374957	hsa-miR-4709-5p	CLIP-seq
MIRT1374958	hsa-miR-4771	CLIP-seq
MIRT1374959	hsa-miR-488	CLIP-seq
MIRT1374960	hsa-miR-539	CLIP-seq
MIRT1374961	hsa-miR-577	CLIP-seq
MIRT1374962	hsa-miR-708	CLIP-seq
MIRT2334646	hsa-miR-425	CLIP-seq
MIRT2334647	hsa-miR-4436a	CLIP-seq
MIRT2334648	hsa-miR-4700-3p	CLIP-seq
MIRT2334649	hsa-miR-642b	CLIP-seq
MIRT2460093	hsa-miR-548u	CLIP-seq
MIRT2460093	hsa-miR-548u	CLIP-seq
MIRT2628757	hsa-miR-1	CLIP-seq
MIRT2628758	hsa-miR-105	CLIP-seq
MIRT2628759	hsa-miR-1179	CLIP-seq
MIRT1374946	hsa-miR-1252	CLIP-seq
MIRT2628760	hsa-miR-1267	CLIP-seq
MIRT2628761	hsa-miR-1269	CLIP-seq
MIRT2628762	hsa-miR-1269b	CLIP-seq
MIRT2628763	hsa-miR-128	CLIP-seq
MIRT2628764	hsa-miR-1288	CLIP-seq
MIRT2628765	hsa-miR-130a	CLIP-seq
MIRT2628766	hsa-miR-130b	CLIP-seq
MIRT2628767	hsa-miR-138	CLIP-seq
MIRT2628768	hsa-miR-140-3p	CLIP-seq
MIRT2628769	hsa-miR-147	CLIP-seq
MIRT2628770	hsa-miR-151-5p	CLIP-seq
MIRT2628771	hsa-miR-151b	CLIP-seq
MIRT2628772	hsa-miR-181a	CLIP-seq
MIRT2628773	hsa-miR-181b	CLIP-seq
MIRT2628774	hsa-miR-181c	CLIP-seq
MIRT2628775	hsa-miR-181d	CLIP-seq
MIRT2628776	hsa-miR-185	CLIP-seq
MIRT1374947	hsa-miR-186	CLIP-seq
MIRT2628777	hsa-miR-200b	CLIP-seq
MIRT2628778	hsa-miR-200c	CLIP-seq
MIRT2628779	hsa-miR-2052	CLIP-seq
MIRT2628780	hsa-miR-206	CLIP-seq
MIRT2628781	hsa-miR-2113	CLIP-seq
MIRT2628782	hsa-miR-217	CLIP-seq
MIRT2628783	hsa-miR-27a	CLIP-seq
MIRT2628784	hsa-miR-27b	CLIP-seq
MIRT1374948	hsa-miR-28-3p	CLIP-seq
MIRT1374949	hsa-miR-28-5p	CLIP-seq
MIRT2628785	hsa-miR-301a	CLIP-seq
MIRT2628786	hsa-miR-301b	CLIP-seq
MIRT2628787	hsa-miR-3117-5p	CLIP-seq
MIRT1374950	hsa-miR-3139	CLIP-seq
MIRT2628788	hsa-miR-3146	CLIP-seq
MIRT2628789	hsa-miR-3150b-3p	CLIP-seq
MIRT2628790	hsa-miR-3152-3p	CLIP-seq
MIRT1374951	hsa-miR-3166	CLIP-seq
MIRT2628791	hsa-miR-3168	CLIP-seq
MIRT2628792	hsa-miR-3190	CLIP-seq
MIRT2628793	hsa-miR-34a	CLIP-seq
MIRT2628794	hsa-miR-34c-5p	CLIP-seq
MIRT2628795	hsa-miR-3591-5p	CLIP-seq
MIRT2628796	hsa-miR-3646	CLIP-seq
MIRT2628797	hsa-miR-3662	CLIP-seq
MIRT2628798	hsa-miR-3664-5p	CLIP-seq
MIRT2628799	hsa-miR-3666	CLIP-seq
MIRT2628800	hsa-miR-3673	CLIP-seq
MIRT2628801	hsa-miR-3688-3p	CLIP-seq
MIRT2628802	hsa-miR-3691-5p	CLIP-seq
MIRT2628803	hsa-miR-3692	CLIP-seq
MIRT1374952	hsa-miR-369-3p	CLIP-seq
MIRT2628804	hsa-miR-380	CLIP-seq
MIRT2628805	hsa-miR-3924	CLIP-seq
MIRT1374953	hsa-miR-3944-5p	CLIP-seq
MIRT2628806	hsa-miR-3978	CLIP-seq
MIRT1374954	hsa-miR-421	CLIP-seq
MIRT2628807	hsa-miR-4262	CLIP-seq
MIRT2628808	hsa-miR-4273	CLIP-seq
MIRT2628809	hsa-miR-429	CLIP-seq
MIRT2628810	hsa-miR-4291	CLIP-seq
MIRT2628811	hsa-miR-4295	CLIP-seq
MIRT2628812	hsa-miR-4306	CLIP-seq
MIRT2628813	hsa-miR-4310	CLIP-seq
MIRT2628814	hsa-miR-4318	CLIP-seq
MIRT2628815	hsa-miR-4325	CLIP-seq
MIRT2628816	hsa-miR-4328	CLIP-seq
MIRT2628817	hsa-miR-4418	CLIP-seq
MIRT1374955	hsa-miR-4422	CLIP-seq
MIRT2334647	hsa-miR-4436a	CLIP-seq
MIRT2628818	hsa-miR-4443	CLIP-seq
MIRT2628819	hsa-miR-4459	CLIP-seq
MIRT2628820	hsa-miR-4473	CLIP-seq
MIRT2628821	hsa-miR-4495	CLIP-seq
MIRT2628822	hsa-miR-449a	CLIP-seq
MIRT2628823	hsa-miR-449b	CLIP-seq
MIRT2628824	hsa-miR-4515	CLIP-seq
MIRT2628825	hsa-miR-454	CLIP-seq
MIRT1374956	hsa-miR-4633-3p	CLIP-seq
MIRT2628826	hsa-miR-4644	CLIP-seq
MIRT2628827	hsa-miR-4645-3p	CLIP-seq
MIRT2628828	hsa-miR-4651	CLIP-seq
MIRT2628829	hsa-miR-4652-3p	CLIP-seq
MIRT2628830	hsa-miR-4666-5p	CLIP-seq
MIRT2628831	hsa-miR-4671-3p	CLIP-seq
MIRT2628832	hsa-miR-4677-5p	CLIP-seq
MIRT2628833	hsa-miR-4693-5p	CLIP-seq
MIRT2334648	hsa-miR-4700-3p	CLIP-seq
MIRT1374957	hsa-miR-4709-5p	CLIP-seq
MIRT2628834	hsa-miR-4715-3p	CLIP-seq
MIRT2628835	hsa-miR-4740-5p	CLIP-seq
MIRT2628836	hsa-miR-4752	CLIP-seq
MIRT1374958	hsa-miR-4771	CLIP-seq
MIRT2628837	hsa-miR-4774-5p	CLIP-seq
MIRT2628838	hsa-miR-4784	CLIP-seq
MIRT2628839	hsa-miR-4793-3p	CLIP-seq
MIRT1374959	hsa-miR-488	CLIP-seq
MIRT2628840	hsa-miR-490-5p	CLIP-seq
MIRT2628841	hsa-miR-495	CLIP-seq
MIRT2628842	hsa-miR-499-3p	CLIP-seq
MIRT2628843	hsa-miR-499a-3p	CLIP-seq
MIRT2628844	hsa-miR-509-3-5p	CLIP-seq
MIRT2628845	hsa-miR-509-5p	CLIP-seq
MIRT2628846	hsa-miR-513b	CLIP-seq
MIRT2628847	hsa-miR-522	CLIP-seq
MIRT1374960	hsa-miR-539	CLIP-seq
MIRT2628848	hsa-miR-541	CLIP-seq
MIRT2628849	hsa-miR-543	CLIP-seq
MIRT2628850	hsa-miR-545	CLIP-seq
MIRT2628851	hsa-miR-548c-3p	CLIP-seq
MIRT2460093	hsa-miR-548u	CLIP-seq
MIRT2628852	hsa-miR-561	CLIP-seq
MIRT2628853	hsa-miR-562	CLIP-seq
MIRT1374961	hsa-miR-577	CLIP-seq
MIRT2628854	hsa-miR-599	CLIP-seq
MIRT2628855	hsa-miR-602	CLIP-seq
MIRT2628856	hsa-miR-608	CLIP-seq
MIRT2628857	hsa-miR-613	CLIP-seq
MIRT2628858	hsa-miR-618	CLIP-seq
MIRT2334649	hsa-miR-642b	CLIP-seq
MIRT2628859	hsa-miR-654-5p	CLIP-seq
MIRT1374962	hsa-miR-708	CLIP-seq
MIRT2628860	hsa-miR-765	CLIP-seq
MIRT2628861	hsa-miR-888	CLIP-seq
MIRT2628862	hsa-miR-889	CLIP-seq
MIRT2628863	hsa-miR-892a	CLIP-seq
MIRT2628757	hsa-miR-1	CLIP-seq
MIRT2628758	hsa-miR-105	CLIP-seq
MIRT2628759	hsa-miR-1179	CLIP-seq
MIRT1374946	hsa-miR-1252	CLIP-seq
MIRT2628760	hsa-miR-1267	CLIP-seq
MIRT2628761	hsa-miR-1269	CLIP-seq
MIRT2628762	hsa-miR-1269b	CLIP-seq
MIRT2628763	hsa-miR-128	CLIP-seq
MIRT2628764	hsa-miR-1288	CLIP-seq
MIRT2628765	hsa-miR-130a	CLIP-seq
MIRT2628766	hsa-miR-130b	CLIP-seq
MIRT2628767	hsa-miR-138	CLIP-seq
MIRT2628769	hsa-miR-147	CLIP-seq
MIRT2628770	hsa-miR-151-5p	CLIP-seq
MIRT2628771	hsa-miR-151b	CLIP-seq
MIRT2628772	hsa-miR-181a	CLIP-seq
MIRT2628773	hsa-miR-181b	CLIP-seq
MIRT2628774	hsa-miR-181c	CLIP-seq
MIRT2628775	hsa-miR-181d	CLIP-seq
MIRT2628776	hsa-miR-185	CLIP-seq
MIRT1374947	hsa-miR-186	CLIP-seq
MIRT2628777	hsa-miR-200b	CLIP-seq
MIRT2628778	hsa-miR-200c	CLIP-seq
MIRT2628779	hsa-miR-2052	CLIP-seq
MIRT2628780	hsa-miR-206	CLIP-seq
MIRT2628781	hsa-miR-2113	CLIP-seq
MIRT2628782	hsa-miR-217	CLIP-seq
MIRT2628783	hsa-miR-27a	CLIP-seq
MIRT2628784	hsa-miR-27b	CLIP-seq
MIRT1374948	hsa-miR-28-3p	CLIP-seq
MIRT1374949	hsa-miR-28-5p	CLIP-seq
MIRT2628785	hsa-miR-301a	CLIP-seq
MIRT2628786	hsa-miR-301b	CLIP-seq
MIRT2628787	hsa-miR-3117-5p	CLIP-seq
MIRT1374950	hsa-miR-3139	CLIP-seq
MIRT2628788	hsa-miR-3146	CLIP-seq
MIRT2628789	hsa-miR-3150b-3p	CLIP-seq
MIRT2628790	hsa-miR-3152-3p	CLIP-seq
MIRT1374951	hsa-miR-3166	CLIP-seq
MIRT2628791	hsa-miR-3168	CLIP-seq
MIRT2628792	hsa-miR-3190	CLIP-seq
MIRT2628793	hsa-miR-34a	CLIP-seq
MIRT2628794	hsa-miR-34c-5p	CLIP-seq
MIRT2628795	hsa-miR-3591-5p	CLIP-seq
MIRT2628798	hsa-miR-3664-5p	CLIP-seq
MIRT2628799	hsa-miR-3666	CLIP-seq
MIRT2628800	hsa-miR-3673	CLIP-seq
MIRT2628801	hsa-miR-3688-3p	CLIP-seq
MIRT2628802	hsa-miR-3691-5p	CLIP-seq
MIRT2628803	hsa-miR-3692	CLIP-seq
MIRT1374952	hsa-miR-369-3p	CLIP-seq
MIRT2628804	hsa-miR-380	CLIP-seq
MIRT2628805	hsa-miR-3924	CLIP-seq
MIRT1374953	hsa-miR-3944-5p	CLIP-seq
MIRT2628806	hsa-miR-3978	CLIP-seq
MIRT1374954	hsa-miR-421	CLIP-seq
MIRT2628807	hsa-miR-4262	CLIP-seq
MIRT2628808	hsa-miR-4273	CLIP-seq
MIRT2628809	hsa-miR-429	CLIP-seq
MIRT2628810	hsa-miR-4291	CLIP-seq
MIRT2628811	hsa-miR-4295	CLIP-seq
MIRT2628812	hsa-miR-4306	CLIP-seq
MIRT2628813	hsa-miR-4310	CLIP-seq
MIRT2628814	hsa-miR-4318	CLIP-seq
MIRT2628815	hsa-miR-4325	CLIP-seq
MIRT2628816	hsa-miR-4328	CLIP-seq
MIRT2628817	hsa-miR-4418	CLIP-seq
MIRT1374955	hsa-miR-4422	CLIP-seq
MIRT2334647	hsa-miR-4436a	CLIP-seq
MIRT2628818	hsa-miR-4443	CLIP-seq
MIRT2628820	hsa-miR-4473	CLIP-seq
MIRT2628821	hsa-miR-4495	CLIP-seq
MIRT2628822	hsa-miR-449a	CLIP-seq
MIRT2628823	hsa-miR-449b	CLIP-seq
MIRT2628824	hsa-miR-4515	CLIP-seq
MIRT2628825	hsa-miR-454	CLIP-seq
MIRT1374956	hsa-miR-4633-3p	CLIP-seq
MIRT2628826	hsa-miR-4644	CLIP-seq
MIRT2628827	hsa-miR-4645-3p	CLIP-seq
MIRT2628828	hsa-miR-4651	CLIP-seq
MIRT2628829	hsa-miR-4652-3p	CLIP-seq
MIRT2628831	hsa-miR-4671-3p	CLIP-seq
MIRT2628832	hsa-miR-4677-5p	CLIP-seq
MIRT2691596	hsa-miR-4691-3p	CLIP-seq
MIRT2628833	hsa-miR-4693-5p	CLIP-seq
MIRT2334648	hsa-miR-4700-3p	CLIP-seq
MIRT1374957	hsa-miR-4709-5p	CLIP-seq
MIRT2628834	hsa-miR-4715-3p	CLIP-seq
MIRT2628835	hsa-miR-4740-5p	CLIP-seq
MIRT2628836	hsa-miR-4752	CLIP-seq
MIRT1374958	hsa-miR-4771	CLIP-seq
MIRT2628837	hsa-miR-4774-5p	CLIP-seq
MIRT2628838	hsa-miR-4784	CLIP-seq
MIRT2628839	hsa-miR-4793-3p	CLIP-seq
MIRT1374959	hsa-miR-488	CLIP-seq
MIRT2628840	hsa-miR-490-5p	CLIP-seq
MIRT2628842	hsa-miR-499-3p	CLIP-seq
MIRT2628843	hsa-miR-499a-3p	CLIP-seq
MIRT2628844	hsa-miR-509-3-5p	CLIP-seq
MIRT2628845	hsa-miR-509-5p	CLIP-seq
MIRT2628846	hsa-miR-513b	CLIP-seq
MIRT1374960	hsa-miR-539	CLIP-seq
MIRT2628848	hsa-miR-541	CLIP-seq
MIRT2628849	hsa-miR-543	CLIP-seq
MIRT2628850	hsa-miR-545	CLIP-seq
MIRT2628851	hsa-miR-548c-3p	CLIP-seq
MIRT2460093	hsa-miR-548u	CLIP-seq
MIRT2628852	hsa-miR-561	CLIP-seq
MIRT2628853	hsa-miR-562	CLIP-seq
MIRT1374961	hsa-miR-577	CLIP-seq
MIRT2628854	hsa-miR-599	CLIP-seq
MIRT2628855	hsa-miR-602	CLIP-seq
MIRT2628856	hsa-miR-608	CLIP-seq
MIRT2628857	hsa-miR-613	CLIP-seq
MIRT2628858	hsa-miR-618	CLIP-seq
MIRT2334649	hsa-miR-642b	CLIP-seq
MIRT2628859	hsa-miR-654-5p	CLIP-seq
MIRT1374962	hsa-miR-708	CLIP-seq
MIRT2628860	hsa-miR-765	CLIP-seq
MIRT2628861	hsa-miR-888	CLIP-seq
MIRT2628863	hsa-miR-892a	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
SP1	Unknown	18194215

Show/Hide all(54)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001504	Process	Neurotransmitter uptake	NAS	8760387
GO:0001917	Component	Photoreceptor inner segment	IEA
GO:0005249	Function	Voltage-gated potassium channel activity	IEA
GO:0005484	Function	SNAP receptor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	8692999, 11438518, 15603740, 26635000
GO:0005737	Component	Cytoplasm	IDA	24327345
GO:0005737	Component	Cytoplasm	ISS
GO:0005802	Component	Trans-Golgi network	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IDA	24327345
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0006887	Process	Exocytosis	IBA	21873635
GO:0006906	Process	Vesicle fusion	IBA	21873635
GO:0007268	Process	Chemical synaptic transmission	NAS	8760387
GO:0007269	Process	Neurotransmitter secretion	TAS
GO:0007626	Process	Locomotory behavior	IEA
GO:0008021	Component	Synaptic vesicle	IEA
GO:0008076	Component	Voltage-gated potassium channel complex	ISS
GO:0008306	Process	Associative learning	IEA
GO:0010975	Process	Regulation of neuron projection development	IEA
GO:0014047	Process	Glutamate secretion	TAS
GO:0016020	Component	Membrane	ISS
GO:0016079	Process	Synaptic vesicle exocytosis	TAS	15217342
GO:0016081	Process	Synaptic vesicle docking	NAS	8760387
GO:0016082	Process	Synaptic vesicle priming	IBA	21873635
GO:0017075	Function	Syntaxin-1 binding	IBA	21873635
GO:0017075	Function	Syntaxin-1 binding	IPI	12730201
GO:0019905	Function	Syntaxin binding	IBA	21873635
GO:0030426	Component	Growth cone	ISS
GO:0031083	Component	BLOC-1 complex	IDA	19546860
GO:0031201	Component	SNARE complex	IBA	21873635
GO:0031201	Component	SNARE complex	IDA	12130530, 12730201
GO:0031201	Component	SNARE complex	ISS
GO:0031201	Component	SNARE complex	TAS	15217342
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IEA
GO:0031629	Process	Synaptic vesicle fusion to presynaptic active zone membrane	IBA	21873635
GO:0031982	Component	Vesicle	IDA	15459722
GO:0035579	Component	Specific granule membrane	TAS
GO:0036477	Component	Somatodendritic compartment	IEA
GO:0042734	Component	Presynaptic membrane	TAS	15217342
GO:0043005	Component	Neuron projection	ISS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0048306	Function	Calcium-dependent protein binding	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050796	Process	Regulation of insulin secretion	TAS	15537656
GO:0060291	Process	Long-term synaptic potentiation	IEA
GO:0070032	Component	Synaptobrevin 2-SNAP-25-syntaxin-1a-complexin I complex	IBA	21873635
GO:0070821	Component	Tertiary granule membrane	TAS
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098967	Process	Exocytic insertion of neurotransmitter receptor to postsynaptic membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099590	Process	Neurotransmitter receptor internalization	IEA

MIM	HGNC	e!Ensembl
600322	11132	ENSG00000132639

Protein

UniProt ID

P60880

Protein name

Synaptosomal-associated protein 25 (SNAP-25) (Super protein) (SUP) (Synaptosomal-associated 25 kDa protein)

Protein function

t-SNARE involved in the molecular regulation of neurotransmitter release. May play an important role in the synaptic function of specific neuronal systems. Associates with proteins involved in vesicle docking and membrane fusion. Regulates plasm

PDB

1KIL , 1XTG , 2N1T , 3DDA , 3DDB , 3RK2 , 3RK3 , 3RL0 , 3ZUR , 5W7I , 5W7J , 6JLH , 8BAN , 8BAV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00835	SNAP-25	91 → 141	SNAP-25 family	Family

Tissue specificity

TISSUE SPECIFICITY: Neurons of the neocortex, hippocampus, piriform cortex, anterior thalamic nuclei, pontine nuclei, and granule cells of the cerebellum.

Sequence

MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERI
EEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARV
VDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDR
IMEKADSNKTRIDEANQRATKMLGSG

Sequence length

206

Interactions

View interactions

	KEGG		Reactome
	Synaptic vesicle cycle Insulin secretion		Serotonin Neurotransmitter Release Cycle Norepinephrine Neurotransmitter Release Cycle Glutamate Neurotransmitter Release Cycle Dopamine Neurotransmitter Release Cycle Acetylcholine Neurotransmitter Release Cycle Other interleukin signaling Toxicity of botulinum toxin type A (BoNT/A) Toxicity of botulinum toxin type C (BoNT/C) Toxicity of botulinum toxin type E (BoNT/E) Neutrophil degranulation GABA synthesis, release, reuptake and degradation

Show/Hide Causal Diseases (12)

Disease term	Disease name	dbSNP ID	References
Causal
Arthrogryposis multiplex congenita	Arthrogryposis	rs1586285494, rs80358233, rs137853305, rs1559154278, rs398124167, rs398124172, rs587780399, rs786204576, rs786204430, rs769345284, rs749355583, rs793888524, rs793888525, rs878854368, rs555445835 View all (138 more)
Myasthenic syndrome	Congenital Myasthenic Syndromes, Postsynaptic, Congenital Myasthenic Syndromes, Presynaptic, Presynaptic congenital myasthenic syndromes, Myasthenic Syndromes, Congenital, Myasthenic Syndromes, Congenital, Slow Channel, MYASTHENIC SYNDROME, CONGENITAL, 18	rs606231128, rs606231129, rs606231130, rs606231131, rs606231132, rs118203994, rs118203995, rs863223277, rs606231133, rs121908547, rs121908553, rs121908557, rs104893733, rs104893734, rs121908922 View all (237 more)	25792100, 25381298, 30914295, 27472506
Developmental delay	Global developmental delay	rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291 View all (32 more)
Diabetes mellitus	Diabetes Mellitus, Non-Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237 View all (293 more)	16123366
Epilepsy	Epilepsy, Epilepsies, Partial, Epilepsy, Cryptogenic, Awakening Epilepsy	rs113994140, rs28937874, rs1589762127, rs104894166, rs28939075, rs2134001459, rs104894167, rs119488099, rs119488100, rs387906420, rs121917752, rs121918622, rs281865564, rs387907313, rs397514670 View all (165 more)	29942082
Tourette syndrome	Behavioral tic	rs193302861, rs191284403, rs267606861	17023870
Hearing loss	Sensorineural Hearing Loss (disorder)	rs267607135, rs267606855, rs779841884, rs267606854, rs28942097, rs121908073, rs121908076, rs74315289, rs121908144, rs111033313, rs74315437, rs121908348, rs121908349, rs121908350, rs397515359 View all (184 more)
Mental retardation	Intellectual Disability	rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315 View all (1024 more)
Myasthenia gravis	Myasthenias	rs5030818, rs121912815, rs121912817, rs121912818, rs121912821, rs75466054, rs121912822, rs121912823, rs794727516, rs764497513, rs376808313, rs1279554995, rs1554802792, rs369251527, rs372760913 View all (8 more)
Neurodevelopmental disorders	Neurodevelopmental Disorders	rs869312846, rs869312840, rs869312848, rs869312849, rs869312845, rs886041956, rs1064795110, rs1555762734, rs1555764992, rs1568512728, rs1568532361, rs1595472741, rs1595472764, rs1595476797, rs1016320330, rs1595127294, rs1600392059 View all (2 more)	29942082
Nystagmus	Nystagmus	rs137852207, rs137852208, rs1928435502, rs137852209, rs137852210, rs1929191668, rs137852211, rs137852212, rs2124209414, rs387906720, rs387906721, rs1602791884, rs786205896
Polyneuropathy	Polyneuropathy, Motor	rs1597597437

Show/Hide Unknown Diseases (6)

Disease term	Disease name	References	Source
Unknown
Distal amyotrophy	Distal amyotrophy		ClinVar
Mental depression	Mental Depression, Endogenous depression, Depressive disorder, Unipolar Depression, Depressive Syndrome, Depression, Neurotic	19679075, 14708030	ClinVar
Ptosis	Blepharoptosis, Ptosis		ClinVar
Myasthenic Syndrome	congenital myasthenic syndrome 18, presynaptic congenital myasthenic syndrome		GenCC
Developmental And Epileptic Encephalopathy	genetic developmental and epileptic encephalopathy		GenCC
Endometriosis	Endometriosis		GWAS

Show/Hide Text Mining Associations (82)

Disease Name	Relationship Type	References
Associations from Text Mining
AA amyloidosis	Associate	30846386, 36807763
Alzheimer Disease	Associate	18194215, 26395074, 30342961, 30846386, 33765432, 36807763, 39650656, 40613333
Alzheimer Disease	Inhibit	32776690, 36129947
Antisocial Personality Disorder	Associate	21756448
Ataxia	Associate	36379720
Atrophy	Associate	22832958
Attention Deficit Disorder with Hyperactivity	Associate	18194215, 20679152, 21756448, 22562805, 22773342, 27338073, 31426340, 36068994, 37285328
Autism Spectrum Disorder	Associate	32661233, 37762342
Autistic Disorder	Associate	37762342
Bipolar Disorder	Associate	19125158, 28525603
Brain Damage Chronic	Associate	36008522
Brain Ischemia	Associate	36008522
Breast Neoplasms	Associate	35296631
Carcinoma Neuroendocrine	Associate	36182960
Cerebral Infarction	Associate	36008522
Cognition Disorders	Associate	32776690, 36068994
Cognition Disorders	Inhibit	36129947
Cognitive Dysfunction	Associate	24885975
Colorectal Neoplasms Hereditary Nonpolyposis	Associate	35149954
Critical Illness	Associate	36379720
Delusional Parasitosis	Associate	19806613
Dementia	Inhibit	22832958
Dementia	Associate	40613333
Depressive Disorder Major	Associate	35468096
Developmental Disabilities	Associate	36379720
Diabetes Mellitus Type 2	Associate	26779543
Disruptive Impulse Control and Conduct Disorders	Associate	24391914
Down Syndrome	Associate	34302786
Endometrial Neoplasms	Associate	35149954
Eosinophilic enteropathy	Associate	37478220
Epilepsy	Associate	33299146
Epileptic Encephalopathy Early Infantile 3	Associate	33299146
Fibromyalgia	Associate	24885975
Frontotemporal Dementia	Associate	40613333
Glaucoma	Associate	28575017
Glioblastoma	Inhibit	32412599
Hallucinations	Associate	19806613
Huntington Disease	Associate	17877635
Huntington Disease	Inhibit	36129947
Hypoxia	Inhibit	39236027
Intellectual Disability	Associate	22762387, 33299146
Leukemia Lymphoma Adult T Cell	Associate	29794791
Lewy Body Disease	Inhibit	36129947
Lewy Body Disease	Associate	40613333
Liver Neoplasms	Associate	28855684
Lung Neoplasms	Associate	39236027
Lymphoma Large B Cell Diffuse	Associate	27184832
Lymphoma T Cell Cutaneous	Associate	29794791
Medulloblastoma	Inhibit	28339008
Memory Disorders	Associate	36068994
Mental Disorders	Associate	18194215, 24391914, 24885975, 34638726, 37762342
Metabolic Syndrome	Inhibit	25867398
Microphthalmia Syndromic 10	Associate	33299146
Migraine Disorders	Associate	37380951
Movement Disorders	Associate	33299146
Multiple Sclerosis	Associate	30582321
Myasthenic Syndromes Congenital	Associate	36379720
Myocardial Ischemia	Associate	31192914
Myotilinopathy	Associate	17823282
Neoplasms	Associate	29130426, 29794791, 36182960
Nerve Degeneration	Associate	30846386
Neuroblastoma	Associate	27121208
Neurodegenerative Diseases	Associate	30342961, 34638726
Neurodegenerative Diseases	Inhibit	36129947
Neuroendocrine Tumors	Associate	26439030
Neuroinflammatory Diseases	Associate	30846386
Neuronal Ceroid Lipofuscinoses	Inhibit	26610600
Nystagmus Pathologic	Associate	36379720
Osteoporosis	Associate	36736467
Ovarian Neoplasms	Associate	38527595
Parkinson Disease	Associate	33791366, 36736467
Personality Disorders	Associate	21756448, 24885975
Psychological Trauma	Associate	24885975
Psychotic Disorders	Associate	19806613
Retrograde Degeneration	Associate	30846386, 34302786, 39650656
Schizophrenia	Associate	18194215, 19806613, 28525603
Substance Related Disorders	Associate	21756448
Tauopathies	Associate	32661233
Thrombophilia due to Activated Protein C Resistance	Associate	32661233
Urinary Bladder Overactive	Associate	26241848
Vision Disorders	Associate	33299146
Weight Gain	Associate	36980961

SNAP25 (synaptosome associated protein 25)