SNAI1 (snail family transcriptional repressor 1)

Gene

• Entrez ID: 6615
• Gene name: Snail family transcriptional repressor 1
• Gene symbol: SNAI1
• Synonyms (NCBI Gene): SLUGH2, SNA, SNAH, SNAIL, SNAIL1, dJ710H13.1
• Chromosome: 20
• Chromosome location: 20q13.13
• Summary: The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein,

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004651	hsa-miR-204-5p	Luciferase reporter assay	20056717
MIRT006760	hsa-miR-30a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21633953
MIRT006760	hsa-miR-30a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21633953
MIRT006761	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	21633953
MIRT006761	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	21633953
MIRT006762	hsa-miR-30c-5p	Luciferase reporter assay, qRT-PCR, Western blot	21633953
MIRT006762	hsa-miR-30c-5p	Luciferase reporter assay, qRT-PCR, Western blot	21633953
MIRT006763	hsa-miR-30d-5p	Luciferase reporter assay, qRT-PCR, Western blot	21633953
MIRT006763	hsa-miR-30d-5p	Luciferase reporter assay, qRT-PCR, Western blot	21633953
MIRT006764	hsa-miR-30e-5p	Luciferase reporter assay, qRT-PCR, Western blot	21633953
MIRT006764	hsa-miR-30e-5p	Luciferase reporter assay, qRT-PCR, Western blot	21633953
MIRT007098	hsa-miR-153-3p	Luciferase reporter assay, qRT-PCR, Western blot	23188671
MIRT018418	hsa-miR-335-5p	Microarray	18185580
MIRT022882	hsa-miR-124-3p	Microarray	18668037
MIRT029897	hsa-miR-26b-5p	Microarray	19088304
MIRT052946	hsa-miR-34a-5p	HCT-15 and H1299"	22134354
MIRT052946	hsa-miR-34a-5p	HCT-15 and H1299"	22134354
MIRT052947	hsa-miR-34b-3p	HCT-15 and H1299"	22134354
MIRT052952	hsa-miR-34c-5p	HCT-15 and H1299"	22134354
MIRT052946	hsa-miR-34a-5p	Luciferase reporter assay, Western blot	22134354
MIRT007098	hsa-miR-153-3p	Immunohistochemistry, qRT-PCR, Western blot	25678802
MIRT006760	hsa-miR-30a-5p	Immunohistochemistry, Luciferase reporter assay, QRTPCR, Western blot	24954667
MIRT006760	hsa-miR-30a-5p	Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23831330
MIRT006760	hsa-miR-30a-5p	Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23831330
MIRT437836	hsa-miR-506-3p	Immunofluorescence, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23410973
MIRT438895	hsa-miR-203a-3p	ChIP-seq, Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23447531
MIRT438532	hsa-miR-199a-5p	Luciferase reporter assay, Western blot	25041364
MIRT438532	hsa-miR-199a-5p	Luciferase reporter assay, Western blot	25041364
MIRT438532	hsa-miR-199a-5p	Luciferase reporter assay, Western blot	25041364
MIRT438532	hsa-miR-199a-5p	Luciferase reporter assay, Western blot	25041364
MIRT438895	hsa-miR-203a-3p	ChIP-seq, Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23447531
MIRT438532	hsa-miR-199a-5p	Luciferase reporter assay, Western blot	25041364
MIRT438532	hsa-miR-199a-5p	Luciferase reporter assay, Western blot	25041364
MIRT438532	hsa-miR-199a-5p	Luciferase reporter assay, Western blot	25041364
MIRT438532	hsa-miR-199a-5p	Luciferase reporter assay, Western blot	25041364
MIRT052946	hsa-miR-34a-5p	Luciferase reporter assay, Western blot	28145431
MIRT052946	hsa-miR-34a-5p	Luciferase reporter assay, Western blot	28145431
MIRT007098	hsa-miR-153-3p	Luciferase reporter assay, qRT-PCR, Western blot	26232914
MIRT007098	hsa-miR-153-3p	Luciferase reporter assay, qRT-PCR, Western blot	26232914
MIRT007098	hsa-miR-153-3p	Luciferase reporter assay, qRT-PCR, Western blot	28400282
MIRT007098	hsa-miR-153-3p	Luciferase reporter assay, qRT-PCR, Western blot	28400282
MIRT006762	hsa-miR-30c-5p	Luciferase reporter assay, Western blot	28222434
MIRT006762	hsa-miR-30c-5p	Luciferase reporter assay, Western blot	28222434
MIRT006760	hsa-miR-30a-5p	Luciferase reporter assay, Western blot	28222434
MIRT006760	hsa-miR-30a-5p	Luciferase reporter assay, Western blot	28222434
MIRT732075	hsa-miR-22-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26610210
MIRT732075	hsa-miR-22-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26610210
MIRT004651	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	26729198
MIRT004651	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	26729198
MIRT006606	hsa-miR-30a-5p	Flow, qRT-PCR, Western blot	27212164
MIRT052946	hsa-miR-34a-5p	Microarray, qRT-PCR	33675467
MIRT006760	hsa-miR-30a-5p	qRT-PCR, Western blotting	31772711
MIRT734646	hsa-miR-199b-5p	Luciferase reporter assay, qRT-PCR	31705138
MIRT737572	hsa-miR-30a-3p	Western blotting, qRT-PCR	31772711
MIRT737577	hsa-miR-29b-3p	Microarray, Immunofluorescence, qRT-PCR	31482255
MIRT756063	hsa-miR-370-3p	Luciferase reporter assay, Western blotting, qRT-PCR, EMSA	36083239
MIRT1374756	hsa-miR-1228	CLIP-seq
MIRT1374757	hsa-miR-1236	CLIP-seq
MIRT1374758	hsa-miR-1253	CLIP-seq
MIRT1374759	hsa-miR-1470	CLIP-seq
MIRT1374760	hsa-miR-22	CLIP-seq
MIRT1374761	hsa-miR-296-5p	CLIP-seq
MIRT1374762	hsa-miR-3151	CLIP-seq
MIRT1374763	hsa-miR-3187-3p	CLIP-seq
MIRT1374764	hsa-miR-34a	CLIP-seq
MIRT1374765	hsa-miR-3614-5p	CLIP-seq
MIRT1374766	hsa-miR-3664-3p	CLIP-seq
MIRT1374767	hsa-miR-4286	CLIP-seq
MIRT1374768	hsa-miR-4290	CLIP-seq
MIRT1374769	hsa-miR-4433	CLIP-seq
MIRT1374770	hsa-miR-4459	CLIP-seq
MIRT1374771	hsa-miR-4469	CLIP-seq
MIRT1374772	hsa-miR-4488	CLIP-seq
MIRT1374773	hsa-miR-4493	CLIP-seq
MIRT1374774	hsa-miR-449a	CLIP-seq
MIRT1374775	hsa-miR-449b	CLIP-seq
MIRT1374776	hsa-miR-4529-5p	CLIP-seq
MIRT1374777	hsa-miR-4640-5p	CLIP-seq
MIRT1374778	hsa-miR-4667-3p	CLIP-seq
MIRT1374779	hsa-miR-4697-5p	CLIP-seq
MIRT1374780	hsa-miR-4726-5p	CLIP-seq
MIRT1374781	hsa-miR-4731-5p	CLIP-seq
MIRT1374782	hsa-miR-4747-5p	CLIP-seq
MIRT1374783	hsa-miR-4757-5p	CLIP-seq
MIRT1374784	hsa-miR-4768-3p	CLIP-seq
MIRT1374785	hsa-miR-4779	CLIP-seq
MIRT1374786	hsa-miR-4795-5p	CLIP-seq
MIRT1374787	hsa-miR-486-3p	CLIP-seq
MIRT1374788	hsa-miR-502-5p	CLIP-seq
MIRT1374789	hsa-miR-510	CLIP-seq
MIRT1374790	hsa-miR-544b	CLIP-seq
MIRT1374791	hsa-miR-635	CLIP-seq
MIRT1374792	hsa-miR-637	CLIP-seq
MIRT1374762	hsa-miR-3151	CLIP-seq
MIRT2111556	hsa-miR-3165	CLIP-seq
MIRT1374786	hsa-miR-4795-5p	CLIP-seq
MIRT1374787	hsa-miR-486-3p	CLIP-seq
MIRT2334629	hsa-miR-1197	CLIP-seq
MIRT2334630	hsa-miR-1324	CLIP-seq
MIRT2334631	hsa-miR-204	CLIP-seq
MIRT2334632	hsa-miR-211	CLIP-seq
MIRT2334633	hsa-miR-2114	CLIP-seq
MIRT2334634	hsa-miR-2467-3p	CLIP-seq
MIRT1374761	hsa-miR-296-5p	CLIP-seq
MIRT1374765	hsa-miR-3614-5p	CLIP-seq
MIRT2334635	hsa-miR-3942-3p	CLIP-seq
MIRT1374767	hsa-miR-4286	CLIP-seq
MIRT2334636	hsa-miR-4514	CLIP-seq
MIRT2334637	hsa-miR-4645-5p	CLIP-seq
MIRT2334638	hsa-miR-4673	CLIP-seq
MIRT2334639	hsa-miR-4692	CLIP-seq
MIRT1374761	hsa-miR-296-5p	CLIP-seq
MIRT1374765	hsa-miR-3614-5p	CLIP-seq
MIRT1374767	hsa-miR-4286	CLIP-seq
MIRT1374791	hsa-miR-635	CLIP-seq
MIRT1374756	hsa-miR-1228	CLIP-seq
MIRT2440590	hsa-miR-128	CLIP-seq
MIRT2440591	hsa-miR-1281	CLIP-seq
MIRT2440592	hsa-miR-1291	CLIP-seq
MIRT2334630	hsa-miR-1324	CLIP-seq
MIRT2334631	hsa-miR-204	CLIP-seq
MIRT2440593	hsa-miR-2053	CLIP-seq
MIRT2334632	hsa-miR-211	CLIP-seq
MIRT2334633	hsa-miR-2114	CLIP-seq
MIRT2440594	hsa-miR-27a	CLIP-seq
MIRT2440595	hsa-miR-27b	CLIP-seq
MIRT1374762	hsa-miR-3151	CLIP-seq
MIRT2440596	hsa-miR-3680	CLIP-seq
MIRT2334635	hsa-miR-3942-3p	CLIP-seq
MIRT2440597	hsa-miR-4265	CLIP-seq
MIRT2440598	hsa-miR-4283	CLIP-seq
MIRT2440599	hsa-miR-4292	CLIP-seq
MIRT2440600	hsa-miR-4296	CLIP-seq
MIRT2440601	hsa-miR-4322	CLIP-seq
MIRT2440602	hsa-miR-4447	CLIP-seq
MIRT2440603	hsa-miR-4472	CLIP-seq
MIRT2440604	hsa-miR-4489	CLIP-seq
MIRT2440605	hsa-miR-4715-3p	CLIP-seq
MIRT2440606	hsa-miR-4798-3p	CLIP-seq
MIRT2440607	hsa-miR-491-5p	CLIP-seq
MIRT1374788	hsa-miR-502-5p	CLIP-seq
MIRT1374790	hsa-miR-544b	CLIP-seq
MIRT2440608	hsa-miR-885-5p	CLIP-seq
MIRT2460070	hsa-miR-1287	CLIP-seq
MIRT2460071	hsa-miR-2110	CLIP-seq
MIRT2460072	hsa-miR-3074-5p	CLIP-seq
MIRT2460073	hsa-miR-3135b	CLIP-seq
MIRT2460074	hsa-miR-3667-3p	CLIP-seq
MIRT2460075	hsa-miR-370	CLIP-seq
MIRT2460076	hsa-miR-4271	CLIP-seq
MIRT2460077	hsa-miR-4487	CLIP-seq
MIRT2460078	hsa-miR-4633-3p	CLIP-seq
MIRT2460079	hsa-miR-4667-5p	CLIP-seq
MIRT2460080	hsa-miR-4700-5p	CLIP-seq
MIRT2460081	hsa-miR-4725-3p	CLIP-seq
MIRT1374781	hsa-miR-4731-5p	CLIP-seq
MIRT1374782	hsa-miR-4747-5p	CLIP-seq
MIRT2628652	hsa-miR-1227	CLIP-seq
MIRT1374756	hsa-miR-1228	CLIP-seq
MIRT2440590	hsa-miR-128	CLIP-seq
MIRT2440591	hsa-miR-1281	CLIP-seq
MIRT2440592	hsa-miR-1291	CLIP-seq
MIRT2628653	hsa-miR-1294	CLIP-seq
MIRT2334630	hsa-miR-1324	CLIP-seq
MIRT2334631	hsa-miR-204	CLIP-seq
MIRT2440593	hsa-miR-2053	CLIP-seq
MIRT2334632	hsa-miR-211	CLIP-seq
MIRT2334633	hsa-miR-2114	CLIP-seq
MIRT1374760	hsa-miR-22	CLIP-seq
MIRT2440594	hsa-miR-27a	CLIP-seq
MIRT2440595	hsa-miR-27b	CLIP-seq
MIRT2628654	hsa-miR-3130-3p	CLIP-seq
MIRT1374762	hsa-miR-3151	CLIP-seq
MIRT2111556	hsa-miR-3165	CLIP-seq
MIRT2628655	hsa-miR-3184	CLIP-seq
MIRT2628656	hsa-miR-3650	CLIP-seq
MIRT2440596	hsa-miR-3680	CLIP-seq
MIRT2628657	hsa-miR-3929	CLIP-seq
MIRT2334635	hsa-miR-3942-3p	CLIP-seq
MIRT2628658	hsa-miR-423-5p	CLIP-seq
MIRT2628659	hsa-miR-4261	CLIP-seq
MIRT2440597	hsa-miR-4265	CLIP-seq
MIRT2440598	hsa-miR-4283	CLIP-seq
MIRT2440599	hsa-miR-4292	CLIP-seq
MIRT2440600	hsa-miR-4296	CLIP-seq
MIRT2628660	hsa-miR-4316	CLIP-seq
MIRT2440601	hsa-miR-4322	CLIP-seq
MIRT2628661	hsa-miR-4419b	CLIP-seq
MIRT2440602	hsa-miR-4447	CLIP-seq
MIRT2628662	hsa-miR-4455	CLIP-seq
MIRT1374770	hsa-miR-4459	CLIP-seq
MIRT2440603	hsa-miR-4472	CLIP-seq
MIRT2628663	hsa-miR-4478	CLIP-seq
MIRT2440604	hsa-miR-4489	CLIP-seq
MIRT2628664	hsa-miR-4651	CLIP-seq
MIRT2628665	hsa-miR-4695-5p	CLIP-seq
MIRT2440605	hsa-miR-4715-3p	CLIP-seq
MIRT2440606	hsa-miR-4798-3p	CLIP-seq
MIRT2628666	hsa-miR-485-5p	CLIP-seq
MIRT2440607	hsa-miR-491-5p	CLIP-seq
MIRT1374788	hsa-miR-502-5p	CLIP-seq
MIRT1374790	hsa-miR-544b	CLIP-seq
MIRT2628667	hsa-miR-552	CLIP-seq
MIRT2628668	hsa-miR-608	CLIP-seq
MIRT1374792	hsa-miR-637	CLIP-seq
MIRT2628669	hsa-miR-764	CLIP-seq
MIRT2440608	hsa-miR-885-5p	CLIP-seq
MIRT2628652	hsa-miR-1227	CLIP-seq
MIRT1374756	hsa-miR-1228	CLIP-seq
MIRT2691545	hsa-miR-1254	CLIP-seq
MIRT2440590	hsa-miR-128	CLIP-seq
MIRT2440591	hsa-miR-1281	CLIP-seq
MIRT2440592	hsa-miR-1291	CLIP-seq
MIRT2628653	hsa-miR-1294	CLIP-seq
MIRT2334630	hsa-miR-1324	CLIP-seq
MIRT2691546	hsa-miR-137	CLIP-seq
MIRT2334631	hsa-miR-204	CLIP-seq
MIRT2440593	hsa-miR-2053	CLIP-seq
MIRT2334632	hsa-miR-211	CLIP-seq
MIRT2334633	hsa-miR-2114	CLIP-seq
MIRT1374760	hsa-miR-22	CLIP-seq
MIRT2691547	hsa-miR-25	CLIP-seq
MIRT2440594	hsa-miR-27a	CLIP-seq
MIRT2440595	hsa-miR-27b	CLIP-seq
MIRT2691548	hsa-miR-3116	CLIP-seq
MIRT2628654	hsa-miR-3130-3p	CLIP-seq
MIRT1374762	hsa-miR-3151	CLIP-seq
MIRT2111556	hsa-miR-3165	CLIP-seq
MIRT1374763	hsa-miR-3187-3p	CLIP-seq
MIRT2691549	hsa-miR-32	CLIP-seq
MIRT2691550	hsa-miR-346	CLIP-seq
MIRT2691551	hsa-miR-363	CLIP-seq
MIRT2628656	hsa-miR-3650	CLIP-seq
MIRT2691552	hsa-miR-367	CLIP-seq
MIRT2440596	hsa-miR-3680	CLIP-seq
MIRT2691553	hsa-miR-378g	CLIP-seq
MIRT2628657	hsa-miR-3929	CLIP-seq
MIRT2334635	hsa-miR-3942-3p	CLIP-seq
MIRT2628659	hsa-miR-4261	CLIP-seq
MIRT2440597	hsa-miR-4265	CLIP-seq
MIRT2440598	hsa-miR-4283	CLIP-seq
MIRT2440599	hsa-miR-4292	CLIP-seq
MIRT2440600	hsa-miR-4296	CLIP-seq
MIRT2628660	hsa-miR-4316	CLIP-seq
MIRT2440601	hsa-miR-4322	CLIP-seq
MIRT2691554	hsa-miR-4330	CLIP-seq
MIRT2628661	hsa-miR-4419b	CLIP-seq
MIRT2691555	hsa-miR-4437	CLIP-seq
MIRT2440602	hsa-miR-4447	CLIP-seq
MIRT2628662	hsa-miR-4455	CLIP-seq
MIRT1374770	hsa-miR-4459	CLIP-seq
MIRT2440603	hsa-miR-4472	CLIP-seq
MIRT2628663	hsa-miR-4478	CLIP-seq
MIRT2691556	hsa-miR-4481	CLIP-seq
MIRT2440604	hsa-miR-4489	CLIP-seq
MIRT2691557	hsa-miR-4494	CLIP-seq
MIRT2691558	hsa-miR-4508	CLIP-seq
MIRT1374776	hsa-miR-4529-5p	CLIP-seq
MIRT2628664	hsa-miR-4651	CLIP-seq
MIRT2691559	hsa-miR-4674	CLIP-seq
MIRT2628665	hsa-miR-4695-5p	CLIP-seq
MIRT2440605	hsa-miR-4715-3p	CLIP-seq
MIRT2691560	hsa-miR-4727-5p	CLIP-seq
MIRT2691561	hsa-miR-4745-5p	CLIP-seq
MIRT1374782	hsa-miR-4747-5p	CLIP-seq
MIRT2691562	hsa-miR-4769-3p	CLIP-seq
MIRT2440606	hsa-miR-4798-3p	CLIP-seq
MIRT2628666	hsa-miR-485-5p	CLIP-seq
MIRT2440607	hsa-miR-491-5p	CLIP-seq
MIRT2691563	hsa-miR-499a-5p	CLIP-seq
MIRT1374788	hsa-miR-502-5p	CLIP-seq
MIRT1374790	hsa-miR-544b	CLIP-seq
MIRT2628667	hsa-miR-552	CLIP-seq
MIRT2691564	hsa-miR-554	CLIP-seq
MIRT2628668	hsa-miR-608	CLIP-seq
MIRT1374792	hsa-miR-637	CLIP-seq
MIRT2691565	hsa-miR-661	CLIP-seq
MIRT2628669	hsa-miR-764	CLIP-seq
MIRT2440608	hsa-miR-885-5p	CLIP-seq
MIRT2691566	hsa-miR-92a	CLIP-seq
MIRT2691567	hsa-miR-92b	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CREB1	Repression	15955695
ESRRA	Repression	15955695
HMGA2	Unknown	22241470
HOXA10	Repression	16424022
ID2	Activation	22551584
MTA1	Activation	18719363
MTA3	Repression	23510993
NFKB1	Activation	17665043;18477483
NFKB1	Unknown	19538137
PARP1	Repression	21577210
RELA	Activation	17665043;18477483
RELA	Unknown	19538137
SNAI1	Unknown	16617148

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	11912130
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	15314165
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	11912130
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA	21873635
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	11912130
GO:0001649	Process	Osteoblast differentiation	IEP	20128911
GO:0001650	Component	Fibrillar center	IDA
GO:0001707	Process	Mesoderm formation	ISS
GO:0001837	Process	Epithelial to mesenchymal transition	IDA	16096638
GO:0001837	Process	Epithelial to mesenchymal transition	ISS
GO:0003180	Process	Aortic valve morphogenesis	TAS	20951801
GO:0003198	Process	Epithelial to mesenchymal transition involved in endocardial cushion formation	ISS
GO:0003198	Process	Epithelial to mesenchymal transition involved in endocardial cushion formation	TAS	20951801
GO:0003700	Function	DNA-binding transcription factor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	15448698, 16096638, 18331720, 19411070, 19955572, 20385133, 20389281, 20562920, 21577210, 23644467, 24209753, 25203322, 25314079, 25416956, 31515488, 32296183
GO:0005634	Component	Nucleus	IDA	15448698, 19955572, 23288509, 24209753, 25893292
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005721	Component	Pericentric heterochromatin	IDA	24239292
GO:0005737	Component	Cytoplasm	IDA	15448698, 19955572, 24209753
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IMP	20018240, 23288509
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	ISS
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	TAS	17072303
GO:0010957	Process	Negative regulation of vitamin D biosynthetic process	IDA	19502595
GO:0016477	Process	Cell migration	IEA
GO:0019900	Function	Kinase binding	IPI	15448698
GO:0030335	Process	Positive regulation of cell migration	IMP	15314165, 20018240
GO:0031069	Process	Hair follicle morphogenesis	IEA
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	IMP	15314165
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IMP	20018240
GO:0046872	Function	Metal ion binding	IEA
GO:0060021	Process	Roof of mouth development	IEA
GO:0060536	Process	Cartilage morphogenesis	IEA
GO:0060707	Process	Trophoblast giant cell differentiation	IEA
GO:0060806	Process	Negative regulation of cell differentiation involved in embryonic placenta development	IEA
GO:0060972	Process	Left/right pattern formation	IEA
GO:0061314	Process	Notch signaling involved in heart development	ISS
GO:0061314	Process	Notch signaling involved in heart development	TAS	20951801
GO:0070828	Process	Heterochromatin organization	ISS
GO:0070888	Function	E-box binding	IDA	11912130
GO:1902230	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IMP	15314165
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000810	Process	Regulation of bicellular tight junction assembly	IMP	15314165

Other IDs

• MIM: 604238
• HGNC: 11128
• e!Ensembl: ENSG00000124216

Protein

• UniProt ID: O95863
• Protein name: Zinc finger protein SNAI1 (Protein snail homolog 1) (Protein sna)
• Protein function: Involved in induction of the epithelial to mesenchymal transition (EMT), formation and maintenance of embryonic mesoderm, growth arrest, survival and cell migration (PubMed:10655587, PubMed:15647282, PubMed:20389281, PubMed:20562920, PubMed:2195
• PDB: 2Y48, 3W5K, 3ZMT, 4QLI, 8BOX, 8F59, 8FDV, 8FJ7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13912	zf-C2H2_6	153 → 177		Domain
  PF00096	zf-C2H2	180 → 202	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	208 → 230	Zinc finger, C2H2 type	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in a variety of tissues with the highest expression in kidney. Expressed in mesenchymal and epithelial cell lines. {ECO:0000269|PubMed:10655587}.
• Sequence:

  MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLI
  WDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSS
  LEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPC
  VCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQA
  CARTFSRMSLLHKHQESGCSGCPR

• Sequence length: 264

Pathways

KEGG:

Adherens junction

Reactome:

Regulation of PTEN gene transcription

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Amyotrophic lateral sclerosis	Amyotrophic Lateral Sclerosis, Familial	rs267607084, rs312262720, rs312262752, rs121908287, rs121908288, rs29001584, rs28941475, rs121434378, rs386134173, rs386134174, rs80356730, rs80356727, rs4884357, rs80356717, rs80356733, rs80356731, rs80356726, rs267606928, rs267606929, rs121434591, rs121912431, rs121912432, rs121912433, rs121912434, rs121912435, rs121912440, rs121912436, rs121912437, rs121912438, rs121912439, rs74315452, rs121912442, rs121912443, rs121912444, rs121912446, rs121912447, rs1197141604, rs121912448, rs121912449, rs121912450, rs121912451, rs121912452, rs121912453, rs121912454, rs369600566, rs121912455, rs121912456, rs121912457, rs121912458, rs1555836889, rs121909667, rs121909668, rs121909669, rs121909671, rs121909535, rs121909537, rs121909538, rs121909539, rs121909540, rs121909542, rs121909544, rs80356734, rs367543041, rs80356740, rs80356719, rs80356721, rs80356723, rs80356725, rs387906627, rs387906628, rs387906709, rs387906710, rs387906711, rs387906829, rs387907264, rs387907265, rs387907266, rs312262739, rs312262709, rs312262749, rs200793464, rs147713329, rs312262788, rs397514262, rs63751180, rs587777132, rs730880025, rs730880026, rs730880027, rs368743618, rs730880029, rs730882255, rs730882256, rs786205611, rs121912441, rs199947197, rs780136067, rs772731615, rs879253926, rs879254294, rs764717219, rs886041390, rs750159428, rs753207473, rs267607087, rs767350733, rs778305085, rs1554707680, rs1554707622, rs1393363759, rs750959420, rs1555509569, rs1554716504, rs11556620, rs1247392012, rs142083484, rs140385286, rs371575563, rs1402429085, rs1555179091, rs1555179087, rs746971952, rs1555836950, rs368276916, rs140376902, rs747220413, rs76731700, rs770684782, rs1200906022, rs1804449, rs1482760341, rs769898852, rs140599944, rs757972700, rs1555451521, rs1592362719, rs1555836803, rs763455928, rs1378590183, rs1583695322, rs1362178149, rs1197928094, rs368751524, rs1555509609, rs1574787779, rs1601157750, rs1301635320, rs1341055534, rs1402092579, rs1568809172, rs1555836170, rs1315541036, rs1339283341, rs1643659556, rs1644506661, rs1435710212, rs1553122918, rs1689580631, rs374047961, rs775935265, rs2076486420, rs1820836522, rs757260058, rs1844420892, rs1833371664, rs1833438306, rs1833451208, rs2083790483, rs1303294230, rs1226110412, rs2053207945, rs2053208751, rs2053501632, rs2053539304, rs1567479067, rs544088874, rs1228194239, rs1568807400, rs1169198442, rs2049594204, rs2049594311, rs1568810641, rs1568811372, rs2049618449, rs1476760624, rs2079347087	11796754
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158, rs80357524, rs80357115, rs80357945, rs80357729, rs80357609, rs80357259, rs80357981, rs80358063, rs80357389, rs80356862, rs80359876, rs80357580, rs80358053, rs80358089, rs80187739, rs397507241, rs80358069, rs80357590, rs80357284, rs80357941, rs80359261, rs80359272, rs80359276, rs276174813, rs80358474, rs80359316, rs1555282969, rs80359388, rs80359499, rs80359505, rs80359520, rs80359526, rs80359533, rs56253082, rs80358824, rs80359554, rs80359636, rs80359651, rs80359659, rs80359011, rs80359012, rs80359013, rs80359718, rs397507410, rs81002812, rs80359730, rs80359152, rs80359159, rs397507419, rs28897759, rs80359211, rs80359775, rs397514577, rs397507584, rs80358435, rs80358456, rs80359340, rs80359343, rs80359365, rs80358579, rs397507670, rs80358593, rs80359406, rs80359444, rs80359454, rs276174853, rs276174854, rs80359483, rs80359537, rs80358815, rs80358843, rs80359558, rs80359560, rs80359594, rs80358893, rs28897743, rs397507900, rs397507906, rs397507918, rs80358971, rs80358981, rs397507941, rs80359030, rs80359035, rs41293511, rs397507396, rs81002806, rs80359112, rs397508006, rs81002893, rs45580035, rs80359760, rs397508051, rs80359772, rs4987049, rs80359777, rs80357770, rs397508867, rs62625303, rs397508874, rs80357506, rs80357287, rs273898674, rs80358042, rs80358083, rs80357058, rs41286296, rs80357960, rs80356945, rs80357223, rs386134270, rs80358116, rs80357856, rs80357424, rs397509050, rs80357485, rs80357966, rs397509067, rs80357310, rs80356866, rs80357260, rs80357437, rs80358023, rs80358086, rs80357133, rs80356993, rs80357997, rs80357239, rs80357227, rs397509243, rs80356969, rs80356959, rs63750617, rs63751319, rs587779315, rs200640585, rs398122546, rs80357543, rs398122687, rs80359328, rs398122779, rs398122783, rs62517194, rs80358029, rs515726060, rs180177103, rs180177111, rs180177133, rs587776527, rs180177135, rs180177136, rs515726117, rs587779813, rs587779909, rs587780024, rs587780100, rs28909982, rs121908698, rs180177100, rs587780210, rs587780240, rs587780639, rs587781269, rs587781353, rs587781471, rs587781658, rs587781697, rs587781730, rs587781894, rs587781948, rs587782005, rs587782011, rs200928781, rs587781558, rs370228071, rs587782245, rs587782401, rs180177110, rs587782504, rs72552322, rs587782531, rs587782620, rs587782680, rs587782774, rs587782818, rs730881411, rs730881389, rs564652222, rs397507768, rs587776419, rs730881868, rs730881940, rs56383036, rs758972589, rs201089102, rs730881348, rs786202608, rs786201886, rs786203318, rs786203775, rs786203714, rs786202033, rs750621215, rs786203884, rs786203650, rs772821016, rs863224521, rs864622223, rs864622655, rs375699023, rs876659572, rs768362387, rs876659535, rs876658957, rs483353072, rs876659435, rs267608041, rs876661113, rs730881369, rs878853535, rs772228129, rs878855122, rs760551339, rs80359596, rs397509222, rs886039630, rs886039683, rs886040828, rs587781799, rs886040374, rs886040649, rs397507967, rs878854957, rs886040043, rs1057517589, rs1060502769, rs866380588, rs863224765, rs1064793243, rs747563556, rs1555074976, rs1064795885, rs753961188, rs1064794708, rs869312772, rs1064793887, rs1131690820, rs1135401928, rs1135401868, rs1135401859, rs1553370324, rs397507630, rs1555283160, rs1555283251, rs1555283262, rs1555283361, rs1555286298, rs1555288462, rs886040950, rs1555289566, rs776323117, rs80357123, rs1555579627, rs1555580697, rs80358054, rs1555593302, rs1328985852, rs763470424, rs1555139694, rs878854697, rs1555461217, rs1555461765, rs774684620, rs766416564, rs1554558613, rs1305740166, rs1555461460, rs1555461407, rs1555461586, rs1555567202, rs1555607022, rs1555069815, rs1442299125, rs1474786480, rs1555084947, rs1555457867, rs141087784, rs1482641121, rs1564830522, rs1565469955, rs1565503137, rs864622613, rs755263466, rs757679199, rs1593903166, rs1597801649, rs1603293306, rs879253880, rs80358754, rs1597062038, rs45494092, rs1603275367, rs887358871, rs1597091518, rs1966967065, rs1064793049, rs2082872908, rs2085078278, rs2072475243	24014025, 11850205
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451, rs397507859, rs80359709, rs80359742, rs80359205, rs80357627, rs80357004, rs80357571, rs80357767, rs80357653, rs80358086, rs80357608, rs28897696, rs41293465, rs146650273, rs63751017, rs63750617, rs63750726, rs63750199, rs63749848, rs398122618, rs398122653, rs397509211, rs80357791, rs121912666, rs587778541, rs121908698, rs536907995, rs587781302, rs140342925, rs587781506, rs587782652, rs587782849, rs587783057, rs139770721, rs374950566, rs786202800, rs863224451, rs377153250, rs747727055, rs876658804, rs780001540, rs760815829, rs878854926, rs775248597, rs886040658, rs886040192, rs786203523, rs886040319, rs397508006, rs587782011, rs1060502772, rs1555461727, rs1553333072, rs1114167702, rs1257401983, rs886040950, rs1060502759, rs774684620, rs142947311, rs1555580883, rs748513310, rs376170600, rs863224499, rs1593909229, rs748453607, rs1294578913, rs1574737047, rs1593909960, rs2081922847, rs2082559544, rs2053694038	11850205, 24014025
Cholestasis	Cholestasis	rs121909103, rs751511532, rs376368459, rs762702807, rs1578490102, rs1578499691, rs1578504946, rs1317656688, rs199791850, rs1452792080, rs1578491039	21224055
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802, rs28933369, rs121912469, rs80358011, rs397507262, rs80359439, rs397507333, rs80359543, rs80358831, rs80359596, rs80358920, rs80358972, rs80359659, rs397507404, rs397514661, rs80359516, rs200495564, rs80358419, rs80359274, rs80359283, rs80358427, rs80358428, rs80358435, rs81002805, rs397507660, rs397507663, rs80359391, rs80359443, rs81002797, rs80359466, rs397507752, rs80359484, rs80359603, rs397507954, rs80359058, rs80359071, rs397507981, rs80359121, rs80357086, rs80357064, rs397508936, rs80357695, rs80357661, rs397509035, rs80357544, rs80357577, rs80357881, rs80357296, rs80356923, rs80356866, rs80357504, rs80357390, rs80357239, rs80358099, rs397509284, rs80357258, rs199474738, rs199474747, rs587779204, rs63750439, rs267608076, rs587779246, rs63749999, rs267608078, rs63751327, rs267607719, rs267607734, rs63750706, rs63751711, rs587779047, rs587779075, rs267607949, rs63750633, rs63750803, rs63751618, rs267608154, rs200640585, rs80358018, rs80357857, rs80357882, rs180177103, rs587779815, rs587779865, rs587779872, rs587780059, rs121912666, rs587780088, rs587780104, rs200432447, rs180177100, rs587780226, rs587780784, rs587776416, rs587781276, rs587781629, rs587781694, rs587781727, rs587781730, rs587781807, rs587781894, rs587781948, rs121913344, rs587782292, rs587782350, rs587782558, rs587782719, rs587782885, rs587783057, rs730881833, rs730881411, rs730881336, rs139770721, rs730881869, rs730881633, rs730882007, rs786203115, rs765123255, rs1553333738, rs762083530, rs786202800, rs17174393, rs55996097, rs750621215, rs786203451, rs747604569, rs764389018, rs786204433, rs786204862, rs772821016, rs779582317, rs863225406, rs193922343, rs759965045, rs63749919, rs760228510, rs746481984, rs762307622, rs876659736, rs876660933, rs747727055, rs1450394308, rs876658348, rs876658431, rs876659326, rs876660444, rs730881369, rs878853865, rs753862052, rs587780024, rs138941496, rs886040739, rs886040744, rs886040347, rs878854957, rs886040123, rs398122662, rs886040942, rs1057517104, rs1057516320, rs1057516683, rs879254046, rs1057517253, rs587781927, rs985033810, rs1057519989, rs775464903, rs374230313, rs758304323, rs1060501599, rs758081262, rs1060500126, rs1060502734, rs587776408, rs1060501695, rs1114167816, rs1114167596, rs1114167667, rs1555460315, rs1135402788, rs1554086196, rs730881919, rs773356478, rs769237459, rs1553653158, rs587782087, rs1555107263, rs1555119940, rs1403784434, rs1342519012, rs751710099, rs1553616361, rs1553619721, rs1270783041, rs775036118, rs1555288557, rs1555460548, rs1555461154, rs1298667185, rs1553622218, rs63751101, rs1349928568, rs771936821, rs1021662947, rs1555921011, rs81002831, rs1555124506, rs1555574803, rs1060502716, rs1555605362, rs747057367, rs1565385010, rs1567554500, rs1567516230, rs1558644995, rs1555591308, rs778306619, rs1566231194, rs1603328466, rs1570406302, rs1586108714, rs768362387, rs1597713777, rs1060502926, rs1597867185, rs1591517571, rs1591663236, rs1593903006, rs1555284779, rs1597096243, rs45459799, rs1597360340, rs587781905, rs864622481, rs1601753141, rs1966858562, rs1966967065, rs1967016153, rs1967113484, rs2080473458, rs1591387978, rs1224428422, rs1597747184, rs2082309297, rs2051929740, rs147542208	16367923
Lateral sclerosis	AMYOTROPHIC LATERAL SCLEROSIS 1, Amyotrophic Lateral Sclerosis, Sporadic	rs386134181, rs386134176, rs386134174, rs386134184, rs386134178, rs1693780539, rs1574698048	11796754
Marfan syndrome	Mammary Carcinoma, Human	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465, rs137854466, rs137854467, rs387906547, rs387906548, rs137854469, rs137854473, rs1131692050, rs112989722, rs137854474, rs137854476, rs140593, rs1555395819, rs137854478, rs137854479, rs137854480, rs137854481, rs137854482, rs137854483, rs137854484, rs137854485, rs112289537, rs193922181, rs193922182, rs193922185, rs140603, rs193922187, rs193922188, rs193921256, rs112660651, rs193922193, rs193922194, rs193922197, rs193922198, rs193922199, rs193922203, rs193922204, rs193922205, rs193922206, rs111401431, rs193922207, rs113871094, rs111671429, rs193922216, rs193922219, rs193922220, rs193922223, rs193922224, rs193922225, rs193922226, rs193922227, rs193922228, rs193922230, rs193922235, rs147195031, rs193922236, rs193922239, rs193922240, rs193922241, rs193922246, rs397514558, rs398122934, rs397515753, rs397515754, rs397515755, rs397515756, rs397515757, rs113812345, rs397515758, rs397515759, rs397515762, rs25403, rs397515765, rs397515766, rs397515767, rs397515768, rs397515769, rs397515770, rs397515771, rs25404, rs397515773, rs397515774, rs397515775, rs397515776, rs397515778, rs397515779, rs397515781, rs112202622, rs397515782, rs397515784, rs397515785, rs397515786, rs397515788, rs397515789, rs397515790, rs397515791, rs397515792, rs397515793, rs397515794, rs397515797, rs397515798, rs397515799, rs397515801, rs397515802, rs397515803, rs397515804, rs397515805, rs397515808, rs397515810, rs397515811, rs397515812, rs111231312, rs267606798, rs397515814, rs113905529, rs397515816, rs397515817, rs397515818, rs397515819, rs397515820, rs363853, rs113249837, rs397515821, rs111929350, rs397515823, rs397515824, rs113086760, rs397515825, rs397515826, rs397515827, rs363807, rs397515828, rs397515829, rs397515830, rs397515831, rs397515833, rs111687884, rs113080385, rs397515834, rs397515836, rs113001196, rs397515840, rs397515845, rs397515846, rs397515847, rs397515848, rs397515851, rs397515852, rs397515853, rs397515854, rs111856492, rs397515859, rs397515861, rs397515863, rs397515864, rs397515865, rs397515866, rs397515867, rs137854855, rs199474693, rs587782944, rs587782947, rs587782948, rs672601352, rs876658120, rs727504651, rs727503054, rs727504315, rs727504411, rs727503057, rs727504454, rs200309328, rs363811, rs727504410, rs363821, rs727504347, rs727505006, rs727505110, rs730880356, rs727505269, rs727503058, rs727504421, rs730880107, rs730880104, rs730880103, rs730880102, rs730880101, rs730880106, rs730880100, rs730880105, rs730880099, rs112645512, rs730880108, rs730880098, rs730880097, rs794728321, rs794728283, rs794728280, rs794728336, rs794728272, rs794728160, rs794728271, rs794728270, rs794728319, rs794728262, rs794728251, rs76702162, rs794728335, rs794728334, rs794728246, rs763091520, rs794728333, rs794728237, rs761857514, rs794728234, rs140630, rs794728231, rs794728228, rs794728225, rs794728308, rs794728216, rs794728221, rs763449629, rs201058219, rs794728210, rs794728208, rs794728206, rs794728199, rs794728195, rs794728194, rs794728193, rs794728190, rs1555399381, rs794728176, rs1555399968, rs113422242, rs794728326, rs794728166, rs794728325, rs794728165, rs794728162, rs794728213, rs869025417, rs112642323, rs869025416, rs869025415, rs869025424, rs869025423, rs869025414, rs869025422, rs869025413, rs869025412, rs869025411, rs869025418, rs869025426, rs869025406, rs869025421, rs869025425, rs869025404, rs869025420, rs869025403, rs398122833, rs876657645, rs878853686, rs878853676, rs886038919, rs886038795, rs187553035, rs886038869, rs886038949, rs886038967, rs886038976, rs886038848, rs886038940, rs886038877, rs886039038, rs886038817, rs886038963, rs886039036, rs886038797, rs886039550, rs886041482, rs1057517855, rs1057518912, rs1057518973, rs1057519502, rs1057521100, rs1057521102, rs1057518881, rs1057520617, rs1057521101, rs1555394445, rs369058466, rs1060501069, rs1060501031, rs778966916, rs1060501043, rs1555397663, rs1060501017, rs1060501094, rs1060501065, rs1555393848, rs1555394151, rs1060501051, rs1060501013, rs1060501054, rs1060501048, rs1060501089, rs1060501039, rs1555398160, rs1060501022, rs1060501024, rs1060501086, rs1060501058, rs1060501036, rs1060501100, rs1060501042, rs1060501059, rs1555397743, rs1060501021, rs1060501027, rs1060501096, rs1060501038, rs1060501050, rs1064794130, rs112118237, rs1064793980, rs1064793118, rs1064793636, rs1064794282, rs1064793559, rs1085307921, rs1085308004, rs1085307468, rs112907302, rs1131691479, rs1131691373, rs1131691467, rs1131691938, rs1131691311, rs1131691806, rs1131691317, rs1555393827, rs363804, rs1555397738, rs1555399144, rs1555400274, rs1555394195, rs1555398836, rs113543334, rs1555399825, rs1555394626, rs1555395256, rs1555395257, rs1555396427, rs1555397548, rs1555398173, rs1555404803, rs1232880706, rs1555393825, rs1555394567, rs1555396998, rs1555394928, rs1555397203, rs112375043, rs1555397720, rs140599, rs1555399150, rs1555400373, rs1555405041, rs1555395229, rs1555397671, rs775417975, rs1555398774, rs1555399368, rs1555394904, rs1555395987, rs1555397424, rs1555398377, rs1555398835, rs1555401011, rs1555405043, rs1555394580, rs1555397404, rs1555398511, rs1555395826, rs1555399372, rs1555399821, rs1555399836, rs1555400063, rs363810, rs1555397655, rs1555395756, rs1555395742, rs1555393844, rs112550005, rs1555395002, rs1555395658, rs765387131, rs1555396429, rs1555396835, rs1555397014, rs1555397016, rs778710767, rs1555397557, rs1555397704, rs140648, rs1555398406, rs1555398681, rs1555399257, rs1555399361, rs1555399764, rs1555405056, rs1555393510, rs1555395980, rs1555396789, rs1555399094, rs1555399378, rs1555399816, rs1555395645, rs371097218, rs1555398278, rs1555394238, rs1555396418, rs1206813753, rs1555399271, rs1555405044, rs113544411, rs1555395663, rs1555397216, rs1555398989, rs1555399149, rs1555401670, rs1555395001, rs1445085747, rs1555393538, rs1555393565, rs1404133653, rs1555394450, rs1555394581, rs1555394633, rs1555394900, rs1555395189, rs1555395261, rs1052480459, rs1555395480, rs1555395670, rs363806, rs1555395820, rs1555396419, rs1555396765, rs1296209846, rs794728233, rs1555396853, rs1555396863, rs1555397197, rs1555397204, rs1555397212, rs1555397713, rs1555397736, rs1555398139, rs1555398144, rs1555398409, rs1555398510, rs1555398520, rs1555398524, rs1555398667, rs1555399089, rs1555399482, rs1555399763, rs1555401002, rs794728323, rs1555393508, rs1555393514, rs1555393525, rs1555393532, rs1555393653, rs1555393657, rs1555393824, rs1555393831, rs112196241, rs1555393847, rs1555393862, rs1555393863, rs1555393866, rs113935744, rs1555393882, rs1555393886, rs1555393889, rs1555394138, rs1555394144, rs1555394146, rs1555394148, rs1555394149, rs1555394152, rs1555394153, rs1555394189, rs1555394197, rs1555394206, rs1555394212, rs1555394218, rs1555394220, rs1555394235, rs1555394245, rs1555394246, rs1057520728, rs1555394390, rs1555394391, rs537570299, rs1555394397, rs1555394398, rs1555394399, rs1555394402, rs1555394407, rs1555394412, rs1555394435, rs1555394436, rs1555394441, rs1555394556, rs1555394557, rs1555394559, rs1555394561, rs1555394570, rs397515844, rs1555394571, rs1555394574, rs1555394579, rs1555394582, rs534811966, rs111588631, rs1555394628, rs1555394629, rs1555394630, rs1555394631, rs1555394641, rs1555394644, rs1555394647, rs1555394756, rs886051245, rs1555394775, rs1555394776, rs1555394777, rs1555394779, rs1555394780, rs1555394783, rs1555394901, rs1555394906, rs1555394925, rs794728253, rs886039158, rs1555395013, rs1555395187, rs1555395188, rs1555395203, rs1555395205, rs363815, rs1246984265, rs794728245, rs1555395263, rs1555395267, rs1555395456, rs1555395475, rs1555395482, rs1555395638, rs1555395641, rs1555395648, rs1555395653, rs1555395659, rs111239111, rs1555395745, rs1555395747, rs1555395753, rs1555395757, rs1555395766, rs1555395767, rs1555395843, rs1555395846, rs1555395849, rs1555395978, rs1555395981, rs1555395984, rs1555395989, rs1555395990, rs1260109901, rs1555396186, rs1555396188, rs1555396198, rs1555396199, rs1555396201, rs1555396202, rs1555396205, rs1555396213, rs1555396424, rs1555396426, rs1555396428, rs1555396435, rs1555396630, rs1555396635, rs1555396636, rs1555396639, rs1555396757, rs1555396769, rs1555396838, rs1555396844, rs140627, rs1555396858, rs1555396990, rs1555396991, rs1555396993, rs769588424, rs1555397022, rs1555397024, rs1555397160, rs1555397174, rs1555397176, rs1555397193, rs1555397209, rs1555397210, rs1555397214, rs1060501076, rs113082854, rs113693945, rs111978932, rs1555397403, rs1555397419, rs1555397420, rs1555397421, rs1555397536, rs1555397537, rs1555397540, rs1555397542, rs1555397543, rs1555397545, rs1555397546, rs1555397670, rs1555397692, rs1555397718, rs1555397723, rs1555397744, rs113393517, rs1555398148, rs1555398152, rs1555398174, rs1555398176, rs1555398179, rs1555398282, rs1555398287, rs1555398380, rs1555398394, rs1555398397, rs1555398401, rs1555398404, rs1555398407, rs1555398413, rs1555398501, rs1555398508, rs1555398512, rs1555398513, rs1555398515, rs1555398521, rs794728205, rs1555398527, rs1555398551, rs1060501075, rs1555398566, rs1555398572, rs1555398580, rs1555398582, rs140597, rs1555398622, rs1555398624, rs1555398625, rs112547596, rs1555398627, rs1555398633, rs1555398637, rs1555398642, rs778867355, rs1555398648, rs1555398659, rs1293095681, rs1060501040, rs987202268, rs1555398672, rs1555398673, rs1555398677, rs1555398793, rs1555398803, rs1555398811, rs1555398826, rs1555398833, rs1555398974, rs1555398981, rs778900586, rs1555398988, rs1555398994, rs1555398995, rs1555398996, rs1555399093, rs869025405, rs1555399101, rs1555399146, rs1555399160, rs1555399162, rs1555399164, rs1555399165, rs1555399193, rs1555399195, rs1555399202, rs1555399204, rs1555399206, rs201778577, rs1555399210, rs1555399214, rs1555399270, rs1555399273, rs1555399281, rs1555399371, rs1555399385, rs1555399477, rs1555399484, rs1555399761, rs1555399775, rs1555399802, rs1555399804, rs1555399837, rs1555399840, rs1555399940, rs1555399944, rs1555399949, rs1555399953, rs1555399954, rs1555399955, rs1555399959, rs1555399962, rs1555399963, rs1060501041, rs1555399974, rs1555399976, rs1555399977, rs1555400049, rs794728172, rs1555400062, rs1555400064, rs1555400066, rs1555400267, rs1555400268, rs1555400278, rs794728168, rs1555400279, rs1156747241, rs1555400288, rs1555400371, rs1555400372, rs1555400379, rs1555400385, rs587782943, rs1555400387, rs1555400406, rs1439533354, rs746201757, rs1555400595, rs1555400603, rs1555400604, rs1555400606, rs1555400609, rs752010116, rs1555400612, rs1555400616, rs1555401004, rs1555401005, rs146348130, rs1555401667, rs1555401671, rs1555401676, rs1555401679, rs1555401687, rs1555401689, rs1555401695, rs1555401697, rs1555401701, rs1555404799, rs1555404800, rs200295020, rs1555404810, rs1555404820, rs1555405031, rs1555405039, rs1555405045, rs1555405530, rs794728292, rs1555405533, rs1555405536, rs1555405537, rs111764111, rs1555405658, rs1555405664, rs774371494, rs1555405673, rs1555407399, rs1555407414, rs1555407423, rs1555407429, rs886041536, rs1555404806, rs1566911709, rs1566913974, rs1566894226, rs1566895223, rs1566897376, rs1566902526, rs1566915277, rs1566897374, rs1566897420, rs1566891655, rs1346043320, rs1566922396, rs1566891706, rs1566894783, rs1566913670, rs1555394196, rs1566891454, rs1566891406, rs1566891404, rs1566895262, rs1566891645, rs1566895225, rs1566896114, rs1566898399, rs1566904011, rs1566906537, rs1566908956, rs1566909766, rs1566919599, rs1566937712, rs1566915335, rs1566891675, rs1566904526, rs1566906506, rs1566900540, rs1566894230, rs1555395206, rs1566891797, rs1597512576, rs1597523873, rs1597581001, rs1597516325, rs1057524757, rs1597506641, rs1597520781, rs1597593695, rs1597529829, rs1597520625, rs1597579923, rs1597531796, rs1008275504, rs1597567249, rs1597569265, rs1597652471, rs1597516347, rs1597577114, rs1597633163, rs1597519658, rs1597593852, rs1597516501, rs1566913982, rs1555393859, rs1597513708, rs368978109, rs1480832655, rs1597520683, rs1597522390, rs1597522553, rs1597529748, rs1597533707, rs1597537815, rs1597545309, rs1597545836, rs1597563234, rs1597563280, rs1597564359, rs772108557, rs1597568968, rs1597574236, rs1597574308, rs1597577975, rs193922179, rs1597581005, rs1597593736, rs1597623670, rs1597625734, rs1597631662, rs113604459, rs1597633183, rs1597633219, rs1597518951, rs1555394781, rs1597525871, rs1597526073, rs1597569159, rs1597569536, rs1597563934, rs1597545199, rs1364210063, rs1597552583, rs1597520619, rs1597540854, rs1597591602, rs1597569551, rs1597548716, rs1597553721, rs112728248, rs1597537858, rs1597517935, rs1597540907, rs1597552388, rs1597591643, rs1597529841, rs1597506547, rs1597509836, rs1597529686, rs1566897404, rs1597533713, rs1597543486, rs1597545257, rs1597545345, rs1597548672, rs1597562812, rs1597563287, rs1597571391, rs1555400052, rs1597583989, rs363852, rs1597547226, rs363808, rs974604498, rs2043595650, rs2043526284, rs2042997306, rs1555397195, rs886039054, rs1555397213, rs2042873946	24014025, 11850205
Papillary thyroid carcinoma	Papillary thyroid carcinoma	rs751409106	28030816
Thyroid cancer	Familial Nonmedullary Thyroid Cancer	rs119486096, rs104894171, rs28933406, rs11554290, rs121913364, rs797044990, rs1564566774, rs200989342	28030816

Unknown
Disease term	Disease name	Evidence	References	Source
Psoriasis	Psoriasis			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Achalasia Addisonianism Alacrimia syndrome	Associate	23011797
Adenocarcinoma	Associate	18286686, 23923074, 25120788, 26037169
Adenocarcinoma Mucinous	Associate	34103667
Adenocarcinoma of Lung	Associate	23706092, 25120788, 27191258, 34118147, 34974792, 36071042, 37269912, 38069335, 38182570
Adenocarcinoma of Lung	Inhibit	28077118
Adenoma	Associate	23029563
Adenoma Pleomorphic	Stimulate	31488082
Adenomyosis	Associate	26307032
Adrenal Cortex Neoplasms	Associate	19018264
Adrenocortical Carcinoma	Associate	19018264
Aicardi Syndrome	Associate	19018264
Airway Obstruction	Associate	28883453
Alcoholism	Stimulate	19860811
Argininosuccinic Aciduria	Inhibit	23807225
Arthritis Rheumatoid	Associate	35008549
Astrocytoma	Associate	26654598
Brain Neoplasms	Associate	21914172, 23157797
Breast Neoplasms	Associate	12082640, 15742334, 17761946, 18554584, 19055748, 19277896, 19844232, 20010940, 20109342, 20543867, 21110878, 21315410, 21324165, 21387303, 21914172, 22006115, 22012049, 22024162, 22028892, 22320957, 22511756, 22562246, 23011797, 23671646, 23762395, 24045665, 24191127, 24504364, 25164016, 25420528, 25547164, 25645984, 25938539, 26460733, 26520789, 26617740, 26764010, 26781944, 26968831, 26988558, 27030425, 27829223, 28107418, 28683467, 29115551, 29352246, 29661250, 29729076, 29937187, 30199553, 30621694, 30710426, 30954555, 30964885, 31001932, 31481735, 31488082, 32427827, 32541667, 33428601, 34974534, 35179222, 35605663, 36171192, 36308067, 36431925, 37537694
Breast Neoplasms	Inhibit	28607365, 30798422
Breast Neoplasms	Stimulate	31681835, 31880901
Bronchiolitis Obliterans Syndrome	Associate	19893038
Calcinosis Cutis	Associate	25772244
Carcinogenesis	Associate	20421926, 21206968, 22408413, 23430757, 24800235, 26015410, 28570699, 29065973, 33469676
Carcinoma	Associate	28534983, 31997506
Carcinoma Adenoid Cystic	Associate	28631560, 29424489, 29954240
Carcinoma Ductal	Associate	12082640, 19893985, 22012049, 25645984
Carcinoma Ductal	Stimulate	29937187
Carcinoma Ductal Breast	Associate	22012049, 24966944, 29937187
Carcinoma Endometrioid	Associate	24800235
Carcinoma Hepatocellular	Associate	15026811, 15668718, 18691339, 20385133, 21494073, 21863061, 22511905, 23185371, 23496980, 26362312, 26516929, 26551737, 26655845, 27102441, 27134688, 27420998, 27755964, 27965464, 28230858, 28334716, 28431572, 28584306, 28849004, 29230000, 29603830, 29789583, 30761258, 31469428, 31599450, 32323822, 32657545, 32829570, 33420124, 33469676, 33880590, 34047479, 34338154, 34571852, 34571856, 35345355, 35426224, 35927236, 36675278, 37138218, 37976890
Carcinoma Hepatocellular	Stimulate	36374927
Carcinoma Intraductal Noninfiltrating	Associate	21315410, 24966944, 30544617
Carcinoma Large Cell	Stimulate	25413006
Carcinoma Lobular	Associate	30798422
Carcinoma Non Small Cell Lung	Associate	20234816, 23947765, 24274066, 24662916, 25964055, 27489122, 28412955, 28508744, 28678320, 31444970, 31887300, 32764530, 33381110, 33390536, 33432364, 33621951, 34642464, 36530171, 39865646
Carcinoma Non Small Cell Lung	Stimulate	24253315
Carcinoma Ovarian Epithelial	Associate	19695091, 27044634, 36149163
Carcinoma Pancreatic Ductal	Associate	21288898, 23940742, 24903147, 26062664, 30791220, 31935687, 35327583, 38057853
Carcinoma Renal Cell	Associate	17060462, 20372788, 21808237, 22363672, 23433103, 26261493, 28057716, 31658319, 31915310, 32458971, 36766694, 37569620
Carcinoma Renal Cell	Stimulate	32124963
Carcinoma Small Cell	Associate	25413006
Carcinoma Squamous Cell	Associate	20150431, 21834956, 28708785, 31886179, 32784485, 35763651, 36012449, 36638907, 39294686, 40515636
Cartilage Diseases	Associate	35008549
Cataract	Associate	28442786
Cell Transformation Neoplastic	Associate	18701475, 24721928
Cell Transformation Neoplastic	Stimulate	29065973
Cholangiocarcinoma	Associate	24816558, 32020235, 36317517, 36972768
Chordoma	Associate	29360338
Choroidal Neovascularization	Associate	21617757
Colitis Ulcerative	Associate	31584460, 35484353
Colonic Neoplasms	Associate	19440385, 30770873, 30818851, 31658326, 35217636, 36704936
Colorectal Neoplasms	Associate	16024625, 19502595, 20026903, 20046424, 20138990, 20421926, 21811102, 23029563, 23431386, 23522088, 23996472, 25750173, 26015410, 26379394, 26632346, 26830472, 26992205, 27057280, 27188792, 28104986, 28687755, 29155818, 29297384, 29475734, 29863249, 30135139, 30451989, 30664186, 30770873, 30818851, 31774615, 31830379, 32111819, 32141497, 33291076, 34199046, 34337040, 34526059, 35217636, 35236282, 36258646, 36281556, 36788501, 37017587, 37157810, 37838280, 37933160, 39206995
Colorectal Neoplasms	Stimulate	25738332, 28759954
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	29309923
Death	Associate	18026186
Depressive Disorder	Associate	27322434
Diarrhea 5 With Tufting Enteropathy Congenital	Associate	39849873
Disease	Associate	30598637
Drug Related Side Effects and Adverse Reactions	Associate	25733818, 33390536
Ehlers Danlos Syndrome	Associate	29309923
Ehlers Danlos syndrome type 3	Associate	29309923
Endometrial Hyperplasia	Associate	34517088
Endometrial Neoplasms	Associate	19604315, 22640183, 23114646, 26367784, 26868332, 27171242, 27223076, 33457409, 36140779, 37169340
Endometriosis	Associate	26198055, 35616875, 36232817
Endometritis	Associate	33826645
Epidermolysis bullosa with pyloric atresia	Associate	35145202
Epiretinal Membrane	Associate	21853110, 30679596
Esophageal Neoplasms	Associate	27438288, 28132116
Esophageal Squamous Cell Carcinoma	Associate	17273727, 27902974, 28035369, 32042337, 32323849, 34866524, 35595735, 37038094
Extranodal Extension	Associate	38358184
Fever	Inhibit	23002349
Fibrosis	Associate	27113480, 28883453, 39457089
Frontotemporal Dementia	Associate	37979250
Fuchs' Endothelial Dystrophy	Associate	26302187, 31705138
Fuchs' Endothelial Dystrophy	Stimulate	29294389
Gallbladder Neoplasms	Associate	32812461
Gastrointestinal Stromal Tumors	Associate	31553483
Gingival Overgrowth	Associate	26691272
Glioblastoma	Associate	21225336, 23482671, 23776187, 23826359, 24966907, 26654598, 31037147, 34080022, 37594082, 37863960
Glioblastoma	Inhibit	33692132
Glioma	Associate	24913705, 24959930, 32277674, 34269002
Glomerulosclerosis Focal Segmental	Stimulate	35886848
HAIR AN syndrome	Associate	36199069
Helicobacter Infections	Stimulate	22662230
Hemangioma	Associate	28710904
Hepatitis B	Associate	24191127
Hereditary Breast and Ovarian Cancer Syndrome	Associate	27956696
Hypoxia	Stimulate	14507651, 19844232, 20010940, 22363487, 23002349, 23496980, 25168373, 26379394, 30781795, 36243933
Hypoxia	Associate	18427106, 24859886, 27012941, 27044634, 28764685, 32427827
Hypoxia Brain	Stimulate	27966740
Hypoxia Brain	Associate	30781795
Idiopathic Noncirrhotic Portal Hypertension	Associate	21704007
Idiopathic Noncirrhotic Portal Hypertension	Stimulate	36374927
Idiopathic Pulmonary Fibrosis	Associate	24958208
Inflammation	Associate	22969242, 25120788, 33621951, 35848968, 39294686
Inflammation	Stimulate	25846868
Inflammatory Bowel Diseases	Associate	27113480
Jeune syndrome	Associate	35896673
Joint Instability	Associate	35896673
Keratosis Actinic	Associate	31299087
Kidney Neoplasms	Associate	28057716, 37569620
Klatskin Tumor	Associate	22570087
Liver Cirrhosis	Associate	36871637
Liver Diseases	Associate	33220464
Lung Diseases	Associate	25413006, 29719300
Lung Diseases	Stimulate	35418483
Lung Neoplasms	Associate	22753015, 23157169, 24253315, 25120788, 26722397, 26863455, 27015122, 28146373, 28296173, 28350337, 28678320, 28883453, 28925484, 29371906, 29979729, 29995827, 30191639, 31666207, 31887300, 33471184, 33744858, 34912481, 35178453, 36517633, 37249332
Lymphatic Metastasis	Associate	12082640, 20809941, 22471493, 23157797, 25120788, 25645984, 33817718, 35434126, 35651980, 38358184
Lymphatic Metastasis	Stimulate	17273727, 23151184, 23522088, 23874481, 23923074, 25964055, 26015410, 31774615, 35595735
Lymphoma Large Cell Anaplastic	Associate	28331184
Lymphoma Non Hodgkin	Associate	24481661
Malignant mesenchymal tumor	Stimulate	16521229
Melanoma	Associate	11323412, 19208738, 20856146, 29385656, 29880840, 31171904, 39273022
Melanoma	Stimulate	34769150
Mesothelioma Malignant	Associate	25823924
Mesothelioma Malignant	Stimulate	30609805
Metaplasia	Associate	18385519
Mouth Diseases	Associate	34144151
Mouth Neoplasms	Associate	18234959, 22349639, 29969465, 32928102, 39849873
Multiple Myeloma	Associate	24481661, 28008160, 30781795
Nasal Polyps	Associate	28615628
Nasopharyngeal Carcinoma	Associate	21386845, 22551584, 26497204, 31512056, 36354184, 37563232
Neoplasm Metastasis	Associate	15668718, 18026186, 18701475, 19018264, 19440385, 19844232, 20501852, 21225336, 21386845, 21478114, 21647815, 21808237, 21914172, 22471493, 22471696, 23150175, 23151184, 23301832, 25055044, 25164016, 25499972, 25762643, 26207671, 26219900, 26362312, 26617740, 26729198, 27044634, 27225290, 27532429, 27706678, 28247446, 28281966, 28550287, 29250652, 29259250, 29271982, 29603830, 30052810, 30400838, 30451989, 30770873, 30975732, 31221586, 31426719, 31449546, 31512056, 31935687, 32111819, 33291076, 33880590, 34269002, 34571856, 35179222, 35197444, 35595735, 35927236, 38057853, 39273022, 39294686
Neoplasm Metastasis	Stimulate	21439681, 23577117, 25409617, 30231243, 31774615
Neoplasm Metastasis	Inhibit	24059685, 36354184
Neoplasms	Associate	12082640, 15026811, 15668718, 16024625, 17273727, 17761946, 17855508, 18554584, 18691339, 18701475, 19004823, 19018264, 19028702, 19055748, 19208738, 19440385, 19502595, 19844232, 20121949, 20145620, 20150431, 20385133, 20501852, 20562920, 20809941, 21315410, 21439681, 21494073, 21559368, 21678462, 21808237, 21834956, 21853110, 22012049, 22024162, 22080244, 22130069, 22349639, 22408413, 22471493, 22471696, 22568942, 22699938, 22791710, 22857708, 23114646, 23150175, 23246564, 23255607, 23433103, 23522088, 23799116, 23829659, 23874481, 23923074, 24191127, 24349446, 24481661, 24638100, 24675890, 24859886, 24966907, 25078145, 25120788, 25164016, 25251599, 25326810, 25578726, 25889638, 25938539, 25964055, 25989272, 25999348, 26015410, 26107817, 26261493, 26339654, 26520789, 26594799, 26655845, 26764010, 26781944, 26830472, 27030425, 27259998, 27626172, 27956696, 27965464, 28038472, 28065656, 28331184, 28380418, 28570699, 28584306, 28687755, 28759954, 28848200, 29115551, 29250652, 29259250, 29371906, 29729076, 29969465, 29979729, 30451989, 30544617, 30710426, 30744493, 30858175, 30975732, 31036052, 31880901, 31915310, 32033410, 32319576, 32441446, 32541667, 32927665, 32951448, 33381110, 33432364, 33605548, 33652854, 33817718, 34461834, 34974792, 35434126, 35563463, 35597793, 35763651, 36140779, 36149163, 36199069, 36866769, 37038094, 37149929, 37277751, 37569620, 37798384, 38057853, 38113139, 39273022, 39294686, 40243470
Neoplasms	Stimulate	19695091, 21809991, 22201613, 23151184, 24253315, 26823743, 27322434, 27706642, 31040369, 32694700, 36704936, 38358184
Neoplasms	Inhibit	30094882
Neoplasms Germ Cell and Embryonal	Associate	32441446
Nephrosis congenital	Associate	35886848
Neuroendocrine Tumors	Associate	20166136, 37033229, 39682758
Non Muscle Invasive Bladder Neoplasms	Associate	40340993
Obesity	Stimulate	22355352
Osteoarthritis	Associate	35896673, 39738612
Osteoma Osteoid	Stimulate	31488082
Osteosarcoma	Associate	27532429, 27706678, 28365963, 29048621, 30341688, 31173281, 33323539
Ovarian Diseases	Associate	31560827
Ovarian Neoplasms	Associate	14507651, 18026186, 18550773, 18701475, 19695091, 20610539, 21559368, 22429801, 22479527, 25296567, 25326810, 25975373, 26161782, 26298390, 27129171, 27596137, 28427047, 29952249, 30231243, 30628686, 31165775, 31277702, 32096174, 33092644, 33478150, 35379775, 36929633
Ovarian Neoplasms	Stimulate	32547317
Pancreatic Neoplasms	Associate	21288898, 21709440, 22232555, 23940742, 24903147, 25409617, 30158928, 32090981, 33499904, 35300562, 35327583, 36333284, 38057853
Pancreatic Neoplasms	Stimulate	21678462
Papillomavirus Infections	Associate	23778524
Penile Induration	Associate	24294365
Peritonitis	Associate	25296567
Personality Disorders	Associate	20501852, 21478114, 25750173, 31658319, 33291076
Pheochromocytoma	Associate	32190664
Phyllodes Tumor	Associate	23150175
Precancerous Conditions	Associate	37175770
Preeclamptic toxemia	Stimulate	23510993
Prostatic Neoplasms	Associate	17952120, 20385358, 20397042, 21478672, 22857708, 24481661, 24617993, 24859886, 25483191, 25552920, 26037169, 26207671, 26648419, 27409172, 27455254, 27566588, 29164579, 29300772, 30199553, 30631151, 30754655, 32124938, 33605548, 37611675
Prostatic Neoplasms	Stimulate	30065348
Prostatitis	Associate	19901020, 20397042, 27748839, 36232736
Prostatitis	Stimulate	27956696
Pulmonary Disease Chronic Obstructive	Associate	22621770, 28883453, 39969348
Pulmonary Fibrosis	Stimulate	24958208
Pulmonary Fibrosis	Associate	33123215
Radiation Injuries	Associate	29475734
Rectal Neoplasms	Associate	27966740
Respiratory Tract Diseases	Inhibit	29371906
Retinitis	Associate	21853110
Retinoblastoma	Associate	23077401
Rhabdomyosarcoma	Associate	21478114, 32354171
Sarcoma	Associate	21983934
Sarcoma Synovial	Associate	21809991, 33076385
Seminoma	Associate	32441446
Sick Sinus Syndrome	Associate	21439681, 26219900
Skin Neoplasms	Associate	31299087
Small Cell Lung Carcinoma	Stimulate	23157169
Spherocytosis Type 1	Associate	37922232
Squamous Cell Carcinoma of Head and Neck	Associate	21439681, 22201613, 22568942, 22580338, 23874481, 24045665, 25762643, 26214683, 28319306, 29138797, 29250652, 31861233, 32471980, 35434126, 35563463
Squamous Cell Carcinoma of Head and Neck	Stimulate	27259998, 39849873
Stomach Neoplasms	Associate	12414534, 16521229, 20332670, 22471493, 22471696, 22969242, 23151184, 24081672, 24115825, 24721928, 24815301, 24887009, 25055044, 25211665, 25547433, 25832584, 26271669, 26729198, 26846307, 27323966, 27542403, 27706642, 27855404, 27895315, 28550287, 28848200, 29565488, 29794962, 30646925, 30770791, 31814518, 31827075, 31835645, 32329839, 32442162, 35169855, 35596183, 35739527, 35990908, 36580668, 36768307, 37277751, 37537540, 38358184
Synovial Cyst	Associate	35896673
Tachycardia Atrioventricular Nodal Reentry	Associate	20809941
Tertiary Lymphoid Structures	Associate	25420528, 28759954
Testicular Germ Cell Tumor	Associate	35575252
Thyroid Cancer Papillary	Associate	26219900, 27845909, 30832753, 33419089, 35651980
Thyroid Carcinoma Anaplastic	Associate	25078145, 25755746, 35491899
Thyroid Neoplasms	Associate	33333840
Triple Negative Breast Neoplasms	Associate	21315410, 28607365, 29729076, 30964885, 33428601, 34326372, 36171192, 39593161
Triple Negative Breast Neoplasms	Stimulate	30488343
Tuberculosis Multidrug Resistant	Associate	22320957
Urethral Neoplasms	Associate	35763651
Urinary Bladder Neoplasms	Associate	20809941, 24354468, 26844702, 27322434, 27906180, 28837140, 29250666, 29517839, 31221586, 34196584
Uterine Cervical Dysplasia	Associate	30791220
Uterine Cervical Dysplasia	Stimulate	37175770
Uterine Cervical Neoplasms	Associate	23936413, 28212558, 28708785, 29899322, 31205475, 33098235, 36088372, 37175770
Uveal melanoma	Associate	26321866
Varicose Veins	Associate	34944071
Vitreoretinopathy Proliferative	Associate	20528783, 21853110, 39486365
Waldenstrom Macroglobulinemia	Associate	32571273