Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6608
Gene name Gene Name - the full gene name approved by the HGNC.	Smoothened, frizzled class receptor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SMO
Synonyms (NCBI Gene) Gene synonyms aliases	CRJS, FZD11, Gx, PHLS, SMOH
Disease Acronyms (UniProt) Disease acronyms from UniProt database	CRJS, PHLS
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q32.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a G protein-coupled receptor that interacts with the patched protein, a receptor for hedgehog proteins. The encoded protein tranduces signals to other proteins after activation by a hedgehog protein/patched protein comp

Show/Hide all(4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs17710891	G>A,C	Pathogenic, not-provided	Missense variant, coding sequence variant
rs121918347	G>T	Pathogenic	Missense variant, coding sequence variant
rs121918348	G>A	Pathogenic	Missense variant, coding sequence variant
rs879255280	C>T	Pathogenic	Coding sequence variant, missense variant

Show/Hide all(68)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000527	hsa-miR-324-5p	Review, Luciferase reporter assay, Western blot	20216554
MIRT000526	hsa-miR-326	Review, Luciferase reporter assay, Western blot	20216554
MIRT000525	hsa-miR-125b-5p	Review, Luciferase reporter assay, Western blot	20216554
MIRT000527	hsa-miR-324-5p	Luciferase reporter assay, Western blot	18756266
MIRT000526	hsa-miR-326	Luciferase reporter assay, Western blot	18756266
MIRT000525	hsa-miR-125b-5p	Luciferase reporter assay, Western blot	18756266
MIRT006455	hsa-miR-338-3p	Luciferase reporter assay, qRT-PCR, Western blot	21671467
MIRT006455	hsa-miR-338-3p	Luciferase reporter assay, qRT-PCR, Western blot	21671467
MIRT006455	hsa-miR-338-3p	Luciferase reporter assay, qRT-PCR, Western blot	21671467
MIRT006455	hsa-miR-338-3p	Luciferase reporter assay, qRT-PCR, Western blot	21671467
MIRT000526	hsa-miR-326	Western blot	23341351
MIRT000526	hsa-miR-326	Western blot	23341351
MIRT006455	hsa-miR-338-3p	Western blot;qRT-PCR	21671467
MIRT043390	hsa-miR-331-3p	CLASH	23622248
MIRT006455	hsa-miR-338-3p	Western blot	23599646
MIRT000526	hsa-miR-326	Immunofluorescence, qRT-PCR, Luciferase reporter assay, Western blot	25173582
MIRT000526	hsa-miR-326	Immunofluorescence, qRT-PCR, Luciferase reporter assay, Western blot	25173582
MIRT000526	hsa-miR-326	Immunofluorescence, qRT-PCR, Luciferase reporter assay, Western blot	25173582
MIRT000526	hsa-miR-326	Immunofluorescence, qRT-PCR, Luciferase reporter assay, Western blot	25173582
MIRT731771	hsa-miR-218-5p	Luciferase reporter assay, qRT-PCR, Western blot	26261515
MIRT731771	hsa-miR-218-5p	Luciferase reporter assay, qRT-PCR, Western blot	26261515
MIRT731968	hsa-miR-20a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27543062
MIRT731968	hsa-miR-20a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27543062
MIRT737238	hsa-miR-370-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32945196
MIRT1373727	hsa-miR-3929	CLIP-seq
MIRT1373728	hsa-miR-4292	CLIP-seq
MIRT1373729	hsa-miR-4308	CLIP-seq
MIRT1373730	hsa-miR-4419b	CLIP-seq
MIRT1373731	hsa-miR-4478	CLIP-seq
MIRT1373732	hsa-miR-4701-5p	CLIP-seq
MIRT1373733	hsa-miR-588	CLIP-seq
MIRT1373734	hsa-miR-645	CLIP-seq
MIRT1373727	hsa-miR-3929	CLIP-seq
MIRT1373728	hsa-miR-4292	CLIP-seq
MIRT1373729	hsa-miR-4308	CLIP-seq
MIRT1373730	hsa-miR-4419b	CLIP-seq
MIRT1373731	hsa-miR-4478	CLIP-seq
MIRT1373734	hsa-miR-645	CLIP-seq
MIRT2334398	hsa-miR-103a	CLIP-seq
MIRT2334399	hsa-miR-107	CLIP-seq
MIRT2334400	hsa-miR-125a-5p	CLIP-seq
MIRT2334401	hsa-miR-125b	CLIP-seq
MIRT2334402	hsa-miR-1270	CLIP-seq
MIRT2334403	hsa-miR-1273f	CLIP-seq
MIRT2334404	hsa-miR-1913	CLIP-seq
MIRT2334405	hsa-miR-1914	CLIP-seq
MIRT2334406	hsa-miR-3074-5p	CLIP-seq
MIRT2334407	hsa-miR-3189-5p	CLIP-seq
MIRT2334408	hsa-miR-324-3p	CLIP-seq
MIRT2334409	hsa-miR-3659	CLIP-seq
MIRT2334410	hsa-miR-3670	CLIP-seq
MIRT2334411	hsa-miR-3944-5p	CLIP-seq
MIRT2334412	hsa-miR-423-3p	CLIP-seq
MIRT2334413	hsa-miR-4319	CLIP-seq
MIRT2334414	hsa-miR-4658	CLIP-seq
MIRT2334415	hsa-miR-4683	CLIP-seq
MIRT2334416	hsa-miR-4690-3p	CLIP-seq
MIRT2334417	hsa-miR-4710	CLIP-seq
MIRT2334418	hsa-miR-4722-3p	CLIP-seq
MIRT2334419	hsa-miR-4725-5p	CLIP-seq
MIRT2334420	hsa-miR-4728-5p	CLIP-seq
MIRT2334421	hsa-miR-4758-3p	CLIP-seq
MIRT2334422	hsa-miR-503	CLIP-seq
MIRT2334423	hsa-miR-504	CLIP-seq
MIRT2334424	hsa-miR-574-5p	CLIP-seq
MIRT2334425	hsa-miR-620	CLIP-seq
MIRT2334426	hsa-miR-646	CLIP-seq
MIRT2334427	hsa-miR-877	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
GLI3	Activation	15072830

Show/Hide all(86)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0001570	Process	Vasculogenesis	IEA
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001708	Process	Cell fate specification	IEA
GO:0001755	Process	Neural crest cell migration	IEA
GO:0001947	Process	Heart looping	ISS
GO:0002052	Process	Positive regulation of neuroblast proliferation	IEA
GO:0002053	Process	Positive regulation of mesenchymal cell proliferation	IEA
GO:0003140	Process	Determination of left/right asymmetry in lateral mesoderm	ISS
GO:0003323	Process	Type B pancreatic cell development	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005113	Function	Patched binding	IBA	21873635
GO:0005113	Function	Patched binding	IPI	9811851
GO:0005515	Function	Protein binding	IPI	19592253, 21659505
GO:0005794	Component	Golgi apparatus	IDA	11278759
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	19304771
GO:0005901	Component	Caveola	IDA	11278759
GO:0005929	Component	Cilium	IBA	21873635
GO:0005929	Component	Cilium	IDA	27727273
GO:0005929	Component	Cilium	ISS
GO:0005929	Component	Cilium	TAS	21931618
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007224	Process	Smoothened signaling pathway	IBA	21873635
GO:0007224	Process	Smoothened signaling pathway	IEP	17850284
GO:0007224	Process	Smoothened signaling pathway	IMP	9422511, 19304771, 21177415
GO:0007228	Process	Positive regulation of hh target transcription factor activity	ISS
GO:0007371	Process	Ventral midline determination	ISS
GO:0007417	Process	Central nervous system development	IBA	21873635
GO:0007494	Process	Midgut development	ISS
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	21671467
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010629	Process	Negative regulation of gene expression	ISS
GO:0016021	Component	Integral component of membrane	IBA	21873635
GO:0021542	Process	Dentate gyrus development	IEA
GO:0021696	Process	Cerebellar cortex morphogenesis	IEA
GO:0021794	Process	Thalamus development	IEA
GO:0021904	Process	Dorsal/ventral neural tube patterning	IEA
GO:0021910	Process	Smoothened signaling pathway involved in ventral spinal cord patterning	IEA
GO:0021938	Process	Smoothened signaling pathway involved in regulation of cerebellar granule cell precursor cell proliferation	IEA
GO:0021953	Process	Central nervous system neuron differentiation	IEA
GO:0021987	Process	Cerebral cortex development	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	21671467
GO:0030425	Component	Dendrite	IBA	21873635
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030857	Process	Negative regulation of epithelial cell differentiation	IEA
GO:0031069	Process	Hair follicle morphogenesis	IEA
GO:0034504	Process	Protein localization to nucleus	IEA
GO:0035264	Process	Multicellular organism growth	IEA
GO:0040018	Process	Positive regulation of multicellular organism growth	IEA
GO:0042307	Process	Positive regulation of protein import into nucleus	IEA
GO:0042475	Process	Odontogenesis of dentin-containing tooth	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA	11278759
GO:0043392	Process	Negative regulation of DNA binding	ISS
GO:0045880	Process	Positive regulation of smoothened signaling pathway	IBA	21873635
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046622	Process	Positive regulation of organ growth	IEA
GO:0048143	Process	Astrocyte activation	IEA
GO:0048741	Process	Skeletal muscle fiber development	IEA
GO:0048745	Process	Smooth muscle tissue development	IEP	17850284
GO:0048853	Process	Forebrain morphogenesis	ISS
GO:0048873	Process	Homeostasis of number of cells within a tissue	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0050821	Process	Protein stabilization	IEA
GO:0051451	Process	Myoblast migration	IEA
GO:0051799	Process	Negative regulation of hair follicle development	IEA
GO:0060170	Component	Ciliary membrane	TAS
GO:0060242	Process	Contact inhibition	IMP	9422511
GO:0060413	Process	Atrial septum morphogenesis	IEA
GO:0060644	Process	Mammary gland epithelial cell differentiation	IEA
GO:0060684	Process	Epithelial-mesenchymal cell signaling	IEA
GO:0061053	Process	Somite development	ISS
GO:0061113	Process	Pancreas morphogenesis	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070986	Process	Left/right axis specification	IEA
GO:0071397	Process	Cellular response to cholesterol	ISS
GO:0071679	Process	Commissural neuron axon guidance	IBA	21873635
GO:0072285	Process	Mesenchymal to epithelial transition involved in metanephric renal vesicle formation	ISS
GO:0090190	Process	Positive regulation of branching involved in ureteric bud morphogenesis	ISS
GO:0097542	Component	Ciliary tip	TAS
GO:0097731	Component	9+0 non-motile cilium	IEA
GO:2000036	Process	Regulation of stem cell population maintenance	IEA
GO:2000826	Process	Regulation of heart morphogenesis	ISS

MIM	HGNC	e!Ensembl
601500	11119	ENSG00000128602

Protein

UniProt ID

Q99835

Protein name

Protein smoothened (Protein Gx)

Protein function

G protein-coupled receptor which associates with the patched protein (PTCH) to transduce hedgehog protein signaling. Binding of sonic hedgehog (SHH) to its receptor patched prevents inhibition of smoothened (SMO) by patched. When active, SMO bin

PDB

4JKV , 4N4W , 4O9R , 4QIM , 4QIN , 5L7D , 5L7I , 5V56 , 5V57 , 6OT0 , 6XBJ , 6XBK , 6XBL , 6XBM , 7ZI0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01392	Fz	70 → 179	Fz domain	Domain
PF01534	Frizzled	221 → 552	Frizzled/Smoothened family membrane region	Family

Sequence

MAAARPARGPELPLLGLLLLLLLGDPGRGAASSGNATGPGPRSAGGSARRSAAVTGPPPP
LSHCGRAAPCEPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWA
VIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPDRFPEGCTN
EVQNIKFNSSGQCEVPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAV
TGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGT
MRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYF
HLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLI
RGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEW
ERSFRDYVLCQANVTIGLPTKQPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKA
TLLIWRRTWCRLTGQSDDEPKRIKKSKMIAKAFSKRHELLQNPGQELSFSMHTVSHDGPV
AGLAFDLNEPSADVSSAWAQHVTKMVARRGAILPQDISVTPVATPVPPEEQANLWLVEAE
ISPELQKRLGRKKKRRKRKKEVCPLAPPPELHPPAPAPSTIPRLPQLPRQKCLVAAGAWG
AGDSCRQGAWTLVSNPFCPEPSPPQDPFLPSAPAPVAWAHGRRQGLGPIHSRTNLMDTEL
MDADSDF

Sequence length

787

Interactions

View interactions

	KEGG		Reactome
	Hedgehog signaling pathway Axon guidance Pathways in cancer Proteoglycans in cancer Basal cell carcinoma		Hedgehog 'off' state BBSome-mediated cargo-targeting to cilium Hedgehog 'on' state Activation of SMO

Show/Hide Causal Diseases (14)

Disease term	Disease name	dbSNP ID	References
Causal
Agenesis of corpus callosum	Agenesis of corpus callosum	rs754914260, rs1057519053, rs1057519056, rs1057519054, rs1057519055, rs1057519057, rs1384496494, rs1599017933
Carcinoma	Basal cell carcinoma, Carcinoma, Basal Cell	rs121912654, rs555607708, rs786202962, rs1564055259	22679179, 9581815, 26950094, 25759020, 19726788
Carcinoma, somatic	BASAL CELL CARCINOMA, SOMATIC	rs587776628, rs121918347, rs121918348, rs587776689, rs137853214, rs137853215, rs137853216
Congenital ocular coloboma	Congenital ocular coloboma (disorder)	rs587778875, rs587777249, rs767611891, rs2091986259, rs2091987023, rs2091988799
Craniosynostosis	Craniosynostosis	rs104893895, rs587777006, rs587777007, rs587777008, rs587777010, rs864321680, rs864321681, rs1057517670, rs1064794325, rs1555750816, rs1599823350
Curry-jones syndrome	Winter Shortland Temple syndrome, Curry-Jones syndrome	rs879255280	27236920, 24859340
Developmental delay	Global developmental delay	rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291 View all (32 more)
Gastrointestinal stromal tumor	Gastrointestinal Stromal Tumors, Gastrointestinal Stromal Sarcoma	rs587776653, rs74315368, rs74315369, rs587776793, rs587776794, rs587776795, rs606231209, rs121908589, rs121913685, rs121913680, rs794726675, rs587776804, rs121913517, rs121913234, rs121913512 View all (59 more)	27793025
Medulloblastoma	Medulloblastoma	rs1589970134, rs587776578, rs587776579, rs17847577, rs111033171, rs80359604, rs80358785, rs80358814, rs863224925, rs1555950011, rs1554231278, rs926177767, rs759412460, rs1564032829, rs761911009	22679179, 19726788
Meningioma	Meningioma, Meningiomas, Multiple, Clear Cell Meningioma	rs587776563, rs121434259, rs387906857, rs397509405, rs797045990, rs876659443, rs878854603, rs1057518166, rs1060501395, rs1554897280, rs1554898242, rs1555605347, rs587782187, rs1555605750, rs878853937 View all (3 more)	23334667
Mental retardation	Intellectual Disability	rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315 View all (1024 more)
Microphthalmos	Microphthalmos	rs794726862, rs1329285216
Polydactyly	Polydactyly, Polydactyly preaxial type 1	rs1583729398, rs121917709, rs1583734240, rs121917714, rs397507422, rs398122899, rs587776959, rs386833752, rs1057518698, rs1060499558, rs755938967, rs1375768446, rs1309855392, rs1565601979, rs748321474 View all (3 more)	27236920
Syndactyly	Syndactyly	rs878854345, rs104893635, rs28931600, rs587777050, rs587777051, rs606231304

Show/Hide Unknown Diseases (4)

Disease term	Disease name	References	Source
Unknown
Brain neoplasms	Brain Neoplasms, Malignant neoplasm of brain, Benign neoplasm of brain, unspecified, Brain Tumor, Primary, Recurrent Brain Neoplasm, Primary malignant neoplasm of brain	9581815	ClinVar
Hamartoma	Hamartoma, congenital hypothalamic hamartoma syndrome		ClinVar, GenCC
Microcystic meningioma	Microcystic meningioma	23334667	ClinVar
Hirschsprung Disease	Hirschsprung disease		GenCC

Show/Hide Text Mining Associations (104)

Disease Name	Relationship Type	References
Associations from Text Mining
Abnormalities Drug Induced	Associate	19463780
Adamantinoma	Associate	32413283
Adenoameloblastoma	Associate	33144428
Adenocarcinoma	Associate	26317919
Alkaptonuria	Associate	28019670
Ameloblastoma	Associate	24859340, 25854168, 27236920, 29388014, 30216733, 32096304, 35689405
Arthritis Rheumatoid	Associate	24741597, 26189371, 35785032
Astrocytoma	Associate	28082415
Atrioventricular Septal Defect	Associate	32413283
Basal Cell Nevus Syndrome	Associate	25189937, 31758086, 38157930
Basaloid Follicular Hamartoma Syndrome Generalized Autosomal Dominant	Associate	31120550, 35972041
Breast Neoplasms	Associate	16207710, 18563554, 26565916, 29034935, 35381768, 37202799
Capillary Malformation Arteriovenous Malformation	Associate	32413283
Carcinogenesis	Associate	20027224, 34234737
Carcinoma Basal Cell	Associate	11348463, 19726763, 25759019, 25759020, 26546616, 26765315, 27236920, 29423837, 30754660, 31120550, 31756206, 33928395, 34284772, 34972722
Carcinoma Basal Cell	Stimulate	24203628
Carcinoma Ductal	Associate	18636275
Carcinoma Hepatocellular	Associate	16397407, 25944162, 29237157, 33398379
Carcinoma Large Cell	Associate	26317919
Carcinoma Non Small Cell Lung	Associate	36405701
Carcinoma Renal Cell	Stimulate	35266008
Carcinoma Renal Cell	Associate	37240278, 38420990
Carcinoma Squamous Cell	Associate	16778829, 34480080
Cartilage Diseases	Associate	18543049
Cholangiocarcinoma	Associate	36807728
Chondrodysplasia Punctata	Associate	31120550, 35972041
Chondromatosis	Associate	18543049
Chondromatosis Synovial	Associate	18543049
Chondrosarcoma	Associate	18543049
Chromosomal Instability	Associate	36405701
Chromosome Disorders	Associate	22809693
Colonic Neoplasms	Associate	21135115, 21747117, 23097684
Colorectal Neoplasms	Associate	22901214, 23098507, 23202799, 25023548, 29307989
Constipation	Associate	31120550
Ellis Van Creveld Syndrome	Associate	25908617
Esophageal Neoplasms	Associate	21210262
Esophageal Squamous Cell Carcinoma	Associate	21210262
Esophagitis	Associate	26991123
Gastrointestinal Stromal Tumors	Associate	17007023
GATA2 Deficiency	Associate	31724562
Gigantiform Cementoma Familial	Associate	33144428
Glioblastoma	Associate	37830570
Glioma	Associate	37830570
Hamartoma	Associate	28386950, 35137044
Hepatoblastoma	Associate	21159571
Hirschsprung Disease	Associate	32413283
Hyperplasia	Associate	26189371
Hypothalamic hamartomas	Associate	32413283, 35034092
Hypoxia	Stimulate	21338440, 29237157
Hypoxia	Associate	23786654
Idiopathic Pulmonary Fibrosis	Associate	29477141
Intestinal Neoplasms	Associate	17007023
Leiomyoma	Associate	17007023
Leiomyosarcoma	Associate	33396427
Leukemia Lymphocytic Chronic B Cell	Associate	22130798
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	21235817, 26934052, 28704552
Leukemia Myeloid Acute	Associate	26483188, 27258612
Liver Diseases	Associate	28187190
Lymphatic Metastasis	Stimulate	23098507, 33903305
Lymphoma Large B Cell Diffuse	Associate	22809693, 27164089
Maxillary Neoplasms	Associate	29388014
Medulloblastoma	Associate	26286140, 27236920, 31120550, 32576205, 33172502, 33589929, 33978203, 36715306
Meningioma	Associate	20386868, 23334667, 23348505, 25993161, 26826201, 27102344, 27548314, 28082415, 28775249, 33296905, 33772057, 35440040, 37805627, 38066633
Mesothelioma	Associate	23379358, 37139482
Mesothelioma Malignant	Associate	23379358, 24094913, 37139482
Microcephaly	Associate	32413283
Microphthalmia Syndromic 6	Associate	32413283
Myelodysplastic Syndromes	Associate	34314648
Myofibroma	Associate	28386950
Myopathies Structural Congenital	Associate	28386950
Neoplasm Metastasis	Associate	23098507, 27756406, 33903305, 34511489
Neoplasms	Associate	15111311, 19463780, 21159571, 22901214, 23508962, 25023548, 25404506, 25759019, 25759020, 26189371, 26565916, 27236920, 28359267, 29034935, 30861166 View all (10 more)
Neoplasms	Stimulate	17083567, 29230040
Neoplasms Basal Cell	Associate	18543049, 29111235, 38157930
Neurilemmoma	Associate	17007023
Neuroblastoma	Associate	23251412
Neurodegenerative Diseases	Associate	19463780
Neurofibromatosis 2	Associate	23348505
Odontodysplasia	Associate	33144428
Odontogenic Cysts	Associate	33144428
Odontogenic Tumors	Associate	25189937
Odontoma	Associate	33144428
Ossification of Posterior Longitudinal Ligament	Associate	32350355
Osteosarcoma	Associate	34511489
Osteosarcoma	Stimulate	39457084
Pallister Hall Syndrome	Associate	35034092
Pancreatic Neoplasms	Associate	20215540, 21338440, 22450749
Pheochromocytoma	Associate	34234737
Polydactyly Postaxial	Associate	32413283
Prostatic Neoplasms	Associate	20023691, 33955576
Prostatitis	Stimulate	21707705
Sebaceous Gland Neoplasms	Stimulate	29423837
Skin Diseases	Associate	37863651
Skull Base Neoplasms	Associate	23334667, 33087175
Smooth Muscle Tumor	Associate	28386950
Squamous Cell Carcinoma of Head and Neck	Associate	30861166
Stomach Neoplasms	Associate	23349881, 26261515, 28675107, 37863651
Thoracic Injuries	Associate	32413283
Thyroid cancer medullary	Associate	23410206
Triple Negative Breast Neoplasms	Associate	27107440
Urinary Bladder Neoplasms	Associate	33903305
Uterine Cervical Neoplasms	Associate	22028038
Uveal melanoma	Associate	24553082
Winter Shortland Temple syndrome	Associate	27236920, 28386950, 31120550

SMO (smoothened, frizzled class receptor)