Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6605
Gene name Gene Name - the full gene name approved by the HGNC.
SWI/SNF related BAF chromatin remodeling complex subunit E1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SMARCE1
Synonyms (NCBI Gene) Gene synonyms aliases
BAF57, CSS5
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is part of the large ATP-dependent chromatin remodeling complex SWI/SNF, which is required for transcriptional activation of genes normally repressed by chromatin. The encoded protein, either alone or when in the SWI/SNF c
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs201484943 G>A Conflicting-interpretations-of-pathogenicity, likely-benign Synonymous variant, coding sequence variant
rs387906857 T>C,G Likely-pathogenic, pathogenic Coding sequence variant, missense variant
rs397509405 G>A Risk-factor Stop gained, coding sequence variant
rs397509406 A>G Risk-factor Splice donor variant
rs397509407 C>G,T Risk-factor, likely-pathogenic Stop gained, coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020807 hsa-miR-155-5p Proteomics 18668040
MIRT027099 hsa-miR-103a-3p Sequencing 20371350
MIRT029727 hsa-miR-26b-5p Microarray 19088304
MIRT047936 hsa-miR-30c-5p CLASH 23622248
MIRT043752 hsa-miR-328-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000228 Component Nuclear chromosome TAS 9435219
GO:0000776 Component Kinetochore NAS 11078522
GO:0000785 Component Chromatin HDA 16217013
GO:0000785 Component Chromatin NAS 12192000
GO:0003677 Function DNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603111 11109 ENSG00000073584
Protein
UniProt ID Q969G3
Protein name SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 (BRG1-associated factor 57) (BAF57)
Protein function Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromati
PDB 6LTH , 6LTJ , 7CYU , 7VDV , 7Y8R
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00505 HMG_box 66 134 HMG (high mobility group) box Domain
Sequence
MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRVTASSGITIP
KPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYE
AEKIEYNESMKAYH
NSPAYLAYINAKSRAEAALEEESRQRQSRMEKGEPYMSIQPAEDPD
DYDDGFSMKHTATARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRK
LEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEVDMEKIAAEIAQAEEQARKRQ
EEREKEAAEQAERSQSSIVPEEEQAANKGEEKKDDENIPMETEETHLEETTESQQNGEEG
TSTPEDKESGQEGVDSMAEEGTSDSNTGSESNSATVEEPPTDPIPEDEKKE
Sequence length 411
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  ATP-dependent chromatin remodeling
Thermogenesis
Hepatocellular carcinoma
  RMTs methylate histone arginines
RUNX1 interacts with co-factors whose precise effect on RUNX1 targets is not known
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Coffin-Siris Syndrome coffin-siris syndrome 5 rs1555605795, rs387906857, rs1426841589 N/A
Meningioma familial meningioma rs1057518166, rs1060501395, rs1555605347, rs1555605750, rs387906857, rs2037146593, rs397509405, rs2037146907, rs797045990, rs878854603 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma (childhood onset), Atopic asthma, Asthma (age of onset), Asthma N/A N/A GWAS
Dermatitis Atopic dermatitis N/A N/A GWAS
Diabetes Type 1 diabetes N/A N/A GWAS
Eczema Eczema N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 16538531, 16769725, 18332872
Carcinogenesis Inhibit 16135788
Carcinoma Hepatocellular Associate 28740345
Carcinoma Hepatocellular Inhibit 31611549
Carcinoma Non Small Cell Lung Associate 25656847
Cell Transformation Neoplastic Associate 16135788
Coffin Siris syndrome Associate 30548424, 34180430
Diabetes Mellitus Type 1 Associate 22403184
Endometrial Neoplasms Associate 25611552
Familial cylindromatosis Stimulate 16135788