BOLL (boule RNA binding protein)

Gene

• Entrez ID: 66037
• Gene name: Boule RNA binding protein
• Gene symbol: BOLL
• Synonyms (NCBI Gene): BOULE
• Chromosome: 2
• Chromosome location: 2q33.1
• Summary: This gene belongs to the DAZ gene family required for germ cell development. It encodes an RNA-binding protein which is more similar to Drosophila Boule than to human proteins encoded by genes DAZ (deleted in azoospermia) or DAZL (deleted in azoospermia-l

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT445181	hsa-miR-4635	PAR-CLIP	22100165
MIRT445181	hsa-miR-4635	PAR-CLIP	22100165
MIRT823721	hsa-miR-132	CLIP-seq
MIRT823722	hsa-miR-212	CLIP-seq
MIRT823723	hsa-miR-3662	CLIP-seq
MIRT823724	hsa-miR-4477a	CLIP-seq
MIRT823725	hsa-miR-4517	CLIP-seq
MIRT823726	hsa-miR-455-3p	CLIP-seq
MIRT823727	hsa-miR-4775	CLIP-seq
MIRT823728	hsa-miR-590-3p	CLIP-seq
MIRT823729	hsa-miR-665	CLIP-seq
MIRT823730	hsa-miR-181a	CLIP-seq
MIRT823731	hsa-miR-181b	CLIP-seq
MIRT823732	hsa-miR-181c	CLIP-seq
MIRT823733	hsa-miR-181d	CLIP-seq
MIRT823734	hsa-miR-4262	CLIP-seq
MIRT823735	hsa-miR-452	CLIP-seq
MIRT823736	hsa-miR-4676-3p	CLIP-seq
MIRT1943546	hsa-miR-3199	CLIP-seq
MIRT1943547	hsa-miR-4265	CLIP-seq
MIRT1943548	hsa-miR-4289	CLIP-seq
MIRT1943549	hsa-miR-4296	CLIP-seq
MIRT1943550	hsa-miR-4322	CLIP-seq
MIRT1943551	hsa-miR-4648	CLIP-seq
MIRT1943552	hsa-miR-4654	CLIP-seq
MIRT1943553	hsa-miR-4699-3p	CLIP-seq
MIRT1943554	hsa-miR-4769-5p	CLIP-seq
MIRT2182201	hsa-miR-582-5p	CLIP-seq
MIRT2182202	hsa-miR-607	CLIP-seq
MIRT2182203	hsa-miR-664	CLIP-seq
MIRT2435816	hsa-miR-1183	CLIP-seq
MIRT2435817	hsa-miR-1303	CLIP-seq
MIRT823728	hsa-miR-590-3p	CLIP-seq
MIRT2435816	hsa-miR-1183	CLIP-seq
MIRT2435817	hsa-miR-1303	CLIP-seq
MIRT823728	hsa-miR-590-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	IEA
GO:0003730	Function	MRNA 3'-UTR binding	IBA
GO:0005515	Function	Protein binding	IPI	15806553, 16001084, 25416956, 31515488, 32296183, 32814053
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	11390979, 31429579
GO:0005737	Component	Cytoplasm	IEA
GO:0006417	Process	Regulation of translation	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0008494	Function	Translation activator activity	IBA
GO:0008494	Function	Translation activator activity	IDA	16001084
GO:0030154	Process	Cell differentiation	IEA
GO:0042802	Function	Identical protein binding	IPI	15806553
GO:0045948	Process	Positive regulation of translational initiation	IBA
GO:0045948	Process	Positive regulation of translational initiation	IDA	16001084
GO:0051321	Process	Meiotic cell cycle	IDA	12499397
GO:0051321	Process	Meiotic cell cycle	IEA
GO:0070935	Process	3'-UTR-mediated mRNA stabilization	IBA

Other IDs

• MIM: 606165
• HGNC: 14273
• e!Ensembl: ENSG00000152430

Protein

• UniProt ID: Q8N9W6
• Protein name: Protein boule-like
• Protein function: Probable RNA-binding protein, which may be required during spermatogenesis. May act by binding to the 3'-UTR of mRNAs and regulating their translation (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00076	RRM_1	35 → 104	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Testis specific. Not expressed in early embryos, primordial germ cells and spermatogonial cells. First expressed in the cytoplasm of spermatocytes and then persists through meiosis. {ECO:0000269|PubMed:11390979, ECO:0000269|PubMed:1711
• Sequence:

  MQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVK
  EVKIVNDRAGVSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSS
  IMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQPA
  YHYQATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETS
  VPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY

• Sequence length: 283