Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
66037
Gene name Gene Name - the full gene name approved by the HGNC.
Boule RNA binding protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BOLL
Synonyms (NCBI Gene) Gene synonyms aliases
BOULE
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q33.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene belongs to the DAZ gene family required for germ cell development. It encodes an RNA-binding protein which is more similar to Drosophila Boule than to human proteins encoded by genes DAZ (deleted in azoospermia) or DAZL (deleted in azoospermia-l
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT445181 hsa-miR-4635 PAR-CLIP 22100165
MIRT445181 hsa-miR-4635 PAR-CLIP 22100165
MIRT823721 hsa-miR-132 CLIP-seq
MIRT823722 hsa-miR-212 CLIP-seq
MIRT823723 hsa-miR-3662 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding IEA
GO:0003730 Function MRNA 3'-UTR binding IBA
GO:0005515 Function Protein binding IPI 15806553, 16001084, 25416956, 31515488, 32296183, 32814053
GO:0005737 Component Cytoplasm IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606165 14273 ENSG00000152430
Protein
UniProt ID Q8N9W6
Protein name Protein boule-like
Protein function Probable RNA-binding protein, which may be required during spermatogenesis. May act by binding to the 3'-UTR of mRNAs and regulating their translation (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 35 104 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Testis specific. Not expressed in early embryos, primordial germ cells and spermatogonial cells. First expressed in the cytoplasm of spermatocytes and then persists through meiosis. {ECO:0000269|PubMed:11390979, ECO:0000269|PubMed:1711
Sequence
MQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVK
EVKIVNDRAGVSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLN
IGPAIRKQQVGIPRSS
IMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQPA
YHYQATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETS
VPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY
Sequence length 283
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma N/A N/A GWAS
Intracranial Aneurysm Intracranial aneurysm N/A N/A GWAS
Rheumatoid arthritis Rheumatoid arthritis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 19435948
Arrest of spermatogenesis Associate 15705409
Arthritis Rheumatoid Associate 34910834
Azoospermia Associate 35266640
Colorectal Neoplasms Associate 21298349
Esophageal Neoplasms Associate 39287291
Immunodeficiency syndrome variable Associate 26161907
Male Infertility with Large Headed Multiflagellar Polyploid Spermatozoa Inhibit 15066460
Oligospermia Associate 15705409, 35266640
Osteoporosis Associate 34910834