Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	66037
Gene name Gene Name - the full gene name approved by the HGNC.	Boule RNA binding protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	BOLL
Synonyms (NCBI Gene) Gene synonyms aliases	BOULE
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q33.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene belongs to the DAZ gene family required for germ cell development. It encodes an RNA-binding protein which is more similar to Drosophila Boule than to human proteins encoded by genes DAZ (deleted in azoospermia) or DAZL (deleted in azoospermia-l

Show/Hide all(36)

miRTarBase ID	miRNA	Experiments	Reference
MIRT445181	hsa-miR-4635	PAR-CLIP	22100165
MIRT445181	hsa-miR-4635	PAR-CLIP	22100165
MIRT823721	hsa-miR-132	CLIP-seq
MIRT823722	hsa-miR-212	CLIP-seq
MIRT823723	hsa-miR-3662	CLIP-seq
MIRT823724	hsa-miR-4477a	CLIP-seq
MIRT823725	hsa-miR-4517	CLIP-seq
MIRT823726	hsa-miR-455-3p	CLIP-seq
MIRT823727	hsa-miR-4775	CLIP-seq
MIRT823728	hsa-miR-590-3p	CLIP-seq
MIRT823729	hsa-miR-665	CLIP-seq
MIRT823730	hsa-miR-181a	CLIP-seq
MIRT823731	hsa-miR-181b	CLIP-seq
MIRT823732	hsa-miR-181c	CLIP-seq
MIRT823733	hsa-miR-181d	CLIP-seq
MIRT823734	hsa-miR-4262	CLIP-seq
MIRT823735	hsa-miR-452	CLIP-seq
MIRT823736	hsa-miR-4676-3p	CLIP-seq
MIRT1943546	hsa-miR-3199	CLIP-seq
MIRT1943547	hsa-miR-4265	CLIP-seq
MIRT1943548	hsa-miR-4289	CLIP-seq
MIRT1943549	hsa-miR-4296	CLIP-seq
MIRT1943550	hsa-miR-4322	CLIP-seq
MIRT1943551	hsa-miR-4648	CLIP-seq
MIRT1943552	hsa-miR-4654	CLIP-seq
MIRT1943553	hsa-miR-4699-3p	CLIP-seq
MIRT1943554	hsa-miR-4769-5p	CLIP-seq
MIRT2182201	hsa-miR-582-5p	CLIP-seq
MIRT2182202	hsa-miR-607	CLIP-seq
MIRT2182203	hsa-miR-664	CLIP-seq
MIRT2435816	hsa-miR-1183	CLIP-seq
MIRT2435817	hsa-miR-1303	CLIP-seq
MIRT823728	hsa-miR-590-3p	CLIP-seq
MIRT2435816	hsa-miR-1183	CLIP-seq
MIRT2435817	hsa-miR-1303	CLIP-seq
MIRT823728	hsa-miR-590-3p	CLIP-seq

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001650	Component	Fibrillar center	IDA
GO:0003730	Function	MRNA 3'-UTR binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	16001084, 25416956, 31515488, 32814053
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	11390979
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0007275	Process	Multicellular organism development	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0008494	Function	Translation activator activity	IBA	21873635
GO:0008494	Function	Translation activator activity	IDA	16001084
GO:0030154	Process	Cell differentiation	IEA
GO:0045948	Process	Positive regulation of translational initiation	IBA	21873635
GO:0045948	Process	Positive regulation of translational initiation	IDA	16001084
GO:0051321	Process	Meiotic cell cycle	IDA	12499397
GO:0070935	Process	3'-UTR-mediated mRNA stabilization	IBA	21873635
GO:0090543	Component	Flemming body	IDA

MIM	HGNC	e!Ensembl
606165	14273	ENSG00000152430

Protein

UniProt ID

Q8N9W6

Protein name

Protein boule-like

Protein function

Probable RNA-binding protein, which may be required during spermatogenesis. May act by binding to the 3'-UTR of mRNAs and regulating their translation (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	35 → 104	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

Tissue specificity

TISSUE SPECIFICITY: Testis specific. Not expressed in early embryos, primordial germ cells and spermatogonial cells. First expressed in the cytoplasm of spermatocytes and then persists through meiosis. {ECO:0000269|PubMed:11390979, ECO:0000269|PubMed:1711

Sequence

MQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVK
EVKIVNDRAGVSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSS
IMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQPA
YHYQATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETS
VPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY

Sequence length

283

Interactions

View interactions

Show/Hide Causal Diseases (4)

Disease term	Disease name	dbSNP ID	References
Causal
Colorectal cancer	Colorectal Carcinoma	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800 View all (467 more)	17892325
Colorectal neoplasms	Colorectal Neoplasms	rs28929483, rs63751108, rs28929484, rs63749831, rs63750047, rs63751207, rs63749811, rs1553350126, rs63750875, rs63750955, rs587776706, rs63750871, rs587776715, rs63751466, rs63750049 View all (1682 more)	17892325
Intracranial aneurysm	Intracranial Aneurysm	rs1594095223	18997786
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	22923026

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Source
Unknown
Intracranial Aneurysm	Intracranial Aneurysm	GWAS
Rheumatoid arthritis	Rheumatoid arthritis	GWAS
Asthma	Asthma	GWAS

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	19435948
Arrest of spermatogenesis	Associate	15705409
Arthritis Rheumatoid	Associate	34910834
Azoospermia	Associate	35266640
Colorectal Neoplasms	Associate	21298349
Esophageal Neoplasms	Associate	39287291
Immunodeficiency syndrome variable	Associate	26161907
Male Infertility with Large Headed Multiflagellar Polyploid Spermatozoa	Inhibit	15066460
Oligospermia	Associate	15705409, 35266640
Osteoporosis	Associate	34910834
Prostatic Neoplasms	Associate	37279148

BOLL (boule RNA binding protein)