Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6603
Gene name Gene Name - the full gene name approved by the HGNC.
SWI/SNF related BAF chromatin remodeling complex subunit D2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SMARCD2
Synonyms (NCBI Gene) Gene synonyms aliases
BAF60B, CRACD2, PRO2451, Rsc6p, SGD2
Disease Acronyms (UniProt) Disease acronyms from UniProt database
SGD2
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q23.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. T
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs112986541 C>G,T Likely-pathogenic Splice acceptor variant
rs1057518731 C>T Pathogenic Splice donor variant
rs1057518733 A>G Pathogenic Splice donor variant
rs1555580263 ->AGGTAGAACCTTATCTGCCATCTTC Pathogenic Stop gained, coding sequence variant, inframe indel
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004999 hsa-miR-125b-5p Microarray 17891175
MIRT020668 hsa-miR-155-5p Proteomics 18668040
MIRT049267 hsa-miR-92a-3p CLASH 23622248
MIRT049267 hsa-miR-92a-3p CLASH 23622248
MIRT043231 hsa-miR-324-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin HDA 16217013
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IBA 21873635
GO:0003713 Function Transcription coactivator activity NAS 8804307
GO:0005515 Function Protein binding IPI 20148946
GO:0005634 Component Nucleus IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601736 11107 ENSG00000108604
Protein
UniProt ID Q92925
Protein name SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 (60 kDa BRG-1/Brm-associated factor subunit B) (BRG1-associated factor 60B) (BAF60B)
Protein function Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromati
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02201 SWIB 309 381 SWIB/MDM2 domain Domain
Tissue specificity TISSUE SPECIFICITY: Isoform 2 is expressed in the pancreas. {ECO:0000269|PubMed:8804307}.
Sequence
MSGRGAGGFPLPPLSPGGGAVAAALGAPPPPAGPGMLPGPALRGPGPAGGVGGPGAAAFR
PMGPAGPAAQYQRPGMSPGNRMPMAGLQVGPPAGSPFGAAAPLRPGMPPTMMDPFRKRLL
VPQAQPPMPAQRRGLKRRKMADKVLPQRIRELVPESQAYMDLLAFERKLDQTIARKRMEI
QEAIKKPLTQKRKLRIYISNTFSPSKAEGDSAGTAGTPGGTPAGDKVASWELRVEGKLLD
DPSKQKRKFSSFFKSLVIELDKELYGPDNHLVEWHRMPTTQETDGFQVKRPGDLNVKCTL
LLMLDHQPPQYKLDPRLARLLGVHTQTRAAIMQALWLYIKHNQLQDGHEREYINCNRYFR
QIFSCGRLRFSEIPMKLAGLL
QHPDPIVINHVISVDPNDQKKTACYDIDVEVDDPLKAQM
SNFLASTTNQQEIASLDVKIHETIESINQLKTQRDFMLSFSTDPQDFIQEWLRSQRRDLK
IITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRLT
Sequence length 531
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  ATP-dependent chromatin remodeling
Thermogenesis
Hepatocellular carcinoma
  RMTs methylate histone arginines
RUNX1 interacts with co-factors whose precise effect on RUNX1 targets is not known
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Brachydactyly Brachydactyly rs121908949, rs28937580, rs121909082, rs104894122, rs863223289, rs863223290, rs104894121, rs1587657302, rs863223292, rs74315386, rs74315387, rs28936397, rs753691079, rs121909348, rs121917852
View all (22 more)
Myelodysplasia Myelodysplasia rs141601766, rs1261178797
Myelodysplastic syndrome MYELODYSPLASTIC SYNDROME rs193303018, rs387906631, rs1576745225, rs373145711, rs752746786, rs377023736, rs373221034, rs1576749014, rs1600586587
Neutropenia Neutropenia rs879253882 28369036
Unknown
Disease term Disease name Evidence References Source
Otitis media Recurrent otitis media ClinVar
Specific Granule Deficiency specific granule deficiency, specific granule deficiency 2 GenCC
Associations from Text Mining
Disease Name Relationship Type References
Anxiety Separation Associate 33279574
Failure to Thrive Associate 33279574
Leukemia Myeloid Acute Associate 29483235
Sepsis Associate 33279574