Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	66002
Gene name Gene Name - the full gene name approved by the HGNC.	Cytochrome P450 family 4 subfamily F member 12
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CYP4F12
Synonyms (NCBI Gene) Gene synonyms aliases	CYPIVF12, F22329_1
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.12
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein likel

Show/Hide all(8)

miRTarBase ID	miRNA	Experiments
MIRT2386670	hsa-miR-2277-3p	CLIP-seq
MIRT2386671	hsa-miR-2467-3p	CLIP-seq
MIRT2386672	hsa-miR-4257	CLIP-seq
MIRT2386673	hsa-miR-4514	CLIP-seq
MIRT2386674	hsa-miR-4645-5p	CLIP-seq
MIRT2386675	hsa-miR-4673	CLIP-seq
MIRT2386676	hsa-miR-4692	CLIP-seq
MIRT2386677	hsa-miR-542-3p	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
NR1I2	Unknown	19129222

Show/Hide all(36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000038	Process	Very long-chain fatty acid metabolic process	ISS
GO:0001676	Process	Long-chain fatty acid metabolic process	ISS
GO:0003091	Process	Renal water homeostasis	ISS
GO:0003095	Process	Pressure natriuresis	ISS
GO:0004497	Function	Monooxygenase activity	IEA
GO:0004497	Function	Monooxygenase activity	TAS
GO:0005506	Function	Iron ion binding	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 32296183, 33961781
GO:0005737	Component	Cytoplasm	ISS
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	TAS
GO:0006805	Process	Xenobiotic metabolic process	ISS
GO:0008392	Function	Arachidonate epoxygenase activity	ISS
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	ISS
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016705	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IEA
GO:0018685	Function	Alkane 1-monooxygenase activity	ISS
GO:0019369	Process	Arachidonate metabolic process	IBA
GO:0019369	Process	Arachidonate metabolic process	IEA
GO:0019369	Process	Arachidonate metabolic process	ISS
GO:0019373	Process	Epoxygenase P450 pathway	ISS
GO:0020037	Function	Heme binding	IEA
GO:0036101	Process	Leukotriene B4 catabolic process	ISS
GO:0042360	Process	Vitamin E metabolic process	ISS
GO:0042361	Process	Menaquinone catabolic process	IBA
GO:0042376	Process	Phylloquinone catabolic process	IBA
GO:0043231	Component	Intracellular membrane-bounded organelle	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0050051	Function	Leukotriene-B4 20-monooxygenase activity	ISS
GO:0055078	Process	Sodium ion homeostasis	ISS

MIM	HGNC	e!Ensembl
611485	18857	ENSG00000186204

Protein

UniProt ID

Q9HCS2

Protein name

Cytochrome P450 4F12 (EC 1.14.14.1) (CYPIVF12)

Protein function

A cytochrome P450 monooxygenase involved in the metabolism of endogenous polyunsaturated fatty acids (PUFAs). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00067	p450	52 → 515	Cytochrome P450	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in small intestine, liver, colon and heart. {ECO:0000269|PubMed:11162607, ECO:0000269|PubMed:11162645}.

Sequence

MSLLSLPWLGLRPVATSPWLLLLLVVGSWLLARILAWTYAFYNNCRRLQCFPQPPKRNWF
WGHLGLITPTEEGLKNSTQMSATYSQGFTVWLGPIIPFIVLCHPDTIRSITNASAAIAPK
DNLFIRFLKPWLGEGILLSGGDKWSRHRRMLTPAFHFNILKSYITIFNKSANIMLDKWQH
LASEGSSRLDMFEHISLMTLDSLQKCIFSFDSHCQERPSEYIATILELSALVEKRSQHIL
QHMDFLYYLSHDGRRFHRACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFID
VLLLSKDEDGKALSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQE
LLKDRDPKEIEWDDLAQLPFLTMCVKESLRLHPPAPFISRCCTQDIVLPDGRVIPKGITC
LIDIIGVHHNPTVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKV
VLALMLLHFRFLPDHTEPRRKLELIMRAEGGLWLRVEPLNVSLQ

Sequence length

524

Interactions

View interactions

	Reactome
			Fatty acids Eicosanoids

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Glioma	Glioma	N/A	N/A	GWAS

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Carcinoma Hepatocellular	Associate	30280198
Cerebral Hemorrhage	Associate	26795600
Cerebral Infarction	Associate	28487959
Colonic Neoplasms	Inhibit	32293332
Hemangioma Cavernous Central Nervous System	Associate	26795600
Neoplasms	Associate	37414830
Personality Disorders	Associate	33450964
Prostatic Neoplasms	Associate	33450964, 37924098
Squamous Cell Carcinoma of Head and Neck	Associate	37414830

CYP4F12 (cytochrome P450 family 4 subfamily F member 12)