TMEM108 (transmembrane protein 108)

Gene

• Entrez ID: 66000
• Gene name: Transmembrane protein 108
• Gene symbol: TMEM108
• Synonyms (NCBI Gene): CT124, RTLN
• Chromosome: 3
• Chromosome location: 3q22.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT047062	hsa-miR-183-5p	CLASH	23622248
MIRT734803	hsa-miR-3148	RNA-seq	31540331
MIRT1429816	hsa-miR-1287	CLIP-seq
MIRT1429817	hsa-miR-150	CLIP-seq
MIRT1429818	hsa-miR-2964a-5p	CLIP-seq
MIRT1429819	hsa-miR-3135b	CLIP-seq
MIRT1429820	hsa-miR-4638-3p	CLIP-seq
MIRT1429821	hsa-miR-4713-5p	CLIP-seq
MIRT1429822	hsa-miR-532-3p	CLIP-seq
MIRT1429823	hsa-miR-942	CLIP-seq
MIRT1429824	hsa-miR-1343	CLIP-seq
MIRT1429825	hsa-miR-139-5p	CLIP-seq
MIRT1429826	hsa-miR-2355-5p	CLIP-seq
MIRT1429827	hsa-miR-4459	CLIP-seq
MIRT1429828	hsa-miR-450b-3p	CLIP-seq
MIRT1429829	hsa-miR-4700-3p	CLIP-seq
MIRT1429830	hsa-miR-4713-3p	CLIP-seq
MIRT1429831	hsa-miR-622	CLIP-seq
MIRT1429832	hsa-miR-638	CLIP-seq
MIRT1429833	hsa-miR-769-3p	CLIP-seq
MIRT2128765	hsa-miR-330-3p	CLIP-seq
MIRT2350369	hsa-miR-1228	CLIP-seq
MIRT2350370	hsa-miR-520d-5p	CLIP-seq
MIRT2350371	hsa-miR-524-5p	CLIP-seq
MIRT2350372	hsa-miR-590-3p	CLIP-seq
MIRT2350373	hsa-miR-615-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IBA
GO:0005769	Component	Early endosome	IEA
GO:0005769	Component	Early endosome	ISS
GO:0006898	Process	Receptor-mediated endocytosis	IEA
GO:0006898	Process	Receptor-mediated endocytosis	ISS
GO:0008090	Process	Retrograde axonal transport	IBA
GO:0008090	Process	Retrograde axonal transport	IEA
GO:0008090	Process	Retrograde axonal transport	ISS
GO:0010008	Component	Endosome membrane	IBA
GO:0010008	Component	Endosome membrane	IEA
GO:0010008	Component	Endosome membrane	ISS
GO:0014069	Component	Postsynaptic density	IBA
GO:0014069	Component	Postsynaptic density	IEA
GO:0014069	Component	Postsynaptic density	ISS
GO:0016020	Component	Membrane	IEA
GO:0021542	Process	Dentate gyrus development	IEA
GO:0021542	Process	Dentate gyrus development	ISS
GO:0030424	Component	Axon	IBA
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS
GO:0030425	Component	Dendrite	IEA
GO:0031175	Process	Neuron projection development	IEA
GO:0031175	Process	Neuron projection development	ISS
GO:0036477	Component	Somatodendritic compartment	IEA
GO:0036477	Component	Somatodendritic compartment	ISS
GO:0042995	Component	Cell projection	IEA
GO:0045202	Component	Synapse	IEA
GO:0051388	Process	Positive regulation of neurotrophin TRK receptor signaling pathway	IEA
GO:0051388	Process	Positive regulation of neurotrophin TRK receptor signaling pathway	ISS
GO:0097106	Process	Postsynaptic density organization	IBA
GO:0097106	Process	Postsynaptic density organization	IEA
GO:0097106	Process	Postsynaptic density organization	ISS
GO:0097484	Process	Dendrite extension	IBA
GO:0097484	Process	Dendrite extension	IEA
GO:0097484	Process	Dendrite extension	ISS
GO:0098696	Process	Regulation of neurotransmitter receptor localization to postsynaptic specialization membrane	IEA
GO:0098815	Process	Modulation of excitatory postsynaptic potential	IEA
GO:0098815	Process	Modulation of excitatory postsynaptic potential	ISS
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:1904115	Component	Axon cytoplasm	IEA
GO:1990416	Process	Cellular response to brain-derived neurotrophic factor stimulus	IEA
GO:1990416	Process	Cellular response to brain-derived neurotrophic factor stimulus	ISS

Other IDs

• MIM: 617361
• HGNC: 28451
• e!Ensembl: ENSG00000144868

Protein

• UniProt ID: Q6UXF1
• Protein name: Transmembrane protein 108 (Retrolinkin)
• Protein function: Transmembrane protein required for proper cognitive functions. Involved in the development of dentate gyrus (DG) neuron circuitry, is necessary for AMPA receptors surface expression and proper excitatory postsynaptic currents of DG granule neuro
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15759	TMEM108	61 → 575	TMEM108 family	Family

• Sequence:

  MKRSLQALYCQLLSFLLILALTEALAFAIQEPSPRESLQVLPSGTPPGTMVTAPHSSTRH
  TSVVMLTPNPDGPPSQAAAPMATPTPRAEGHPPTHTISTIAATVTAPHSESSLSTGPAPA
  AMATTSSKPEGRPRGQAAPTILLTKPPGATSRPTTAPPRTTTRRPPRPPGSSRKGAGNSS
  RPVPPAPGGHSRSKEGQRGRNPSSTPLGQKRPLGKIFQIYKGNFTGSVEPEPSTLTPRTP
  LWGYSSSPQPQTVAATTVPSNTSWAPTTTSLGPAKDKPGLRRAAQGGGSTFTSQGGTPDA
  TAASGAPVSPQAAPVPSQRPHHGDPQDGPSHSDSWLTVTPGTSRPLSTSSGVFTAATGPT
  PAAFDTSVSAPSQGIPQGASTTPQAPTHPSRVSESTISGAKEETVATLTMTDRVPSPLST
  VVSTATGNFLNRLVPAGTWKPGTAGNISHVAEGDKPQHRATICLSKMDIAWVILAISVPI
  SSCSVLLTVCCMKRKKKTANPENNLSYWNNTITMDYFNRHAVELPREIQSLETSEDQLSE
  PRSPANGDYRDTGMVLVNPFCQETLFVGNDQVSEI

• Sequence length: 575

<

Associated diseases

Unknown
Disease merge term	Disease name	Evidence	References	Source
Dementia	Dementia	N/A	N/A	GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Cognition Disorders	Associate	33958783
Colorectal Neoplasms	Associate	36932973
Dementia	Associate	33958783
Parkinson Disease	Associate	33958783