Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	65980
Gene name	Bromodomain containing 9
Gene symbol	BRD9
Synonyms (NCBI Gene)	LAVS3040PRO9856SMARCI2
Chromosome	5
Chromosome location	5p15.33

Show/Hide all (95)

miRTarBase ID	miRNA	Experiments	Reference
MIRT728197	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT728196	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT824540	hsa-miR-1231	CLIP-seq
MIRT824541	hsa-miR-150	CLIP-seq
MIRT824542	hsa-miR-1914	CLIP-seq
MIRT824543	hsa-miR-2115	CLIP-seq
MIRT824544	hsa-miR-329	CLIP-seq
MIRT824545	hsa-miR-335	CLIP-seq
MIRT824546	hsa-miR-3618	CLIP-seq
MIRT824547	hsa-miR-362-3p	CLIP-seq
MIRT824548	hsa-miR-3973	CLIP-seq
MIRT824549	hsa-miR-4288	CLIP-seq
MIRT824550	hsa-miR-4436a	CLIP-seq
MIRT824551	hsa-miR-4502	CLIP-seq
MIRT824552	hsa-miR-4670-5p	CLIP-seq
MIRT824553	hsa-miR-516a-3p	CLIP-seq
MIRT824554	hsa-miR-520g	CLIP-seq
MIRT824555	hsa-miR-520h	CLIP-seq
MIRT824556	hsa-miR-548ae	CLIP-seq
MIRT824557	hsa-miR-548aj	CLIP-seq
MIRT824558	hsa-miR-548am	CLIP-seq
MIRT824559	hsa-miR-548x	CLIP-seq
MIRT824560	hsa-miR-550a	CLIP-seq
MIRT824561	hsa-miR-632	CLIP-seq
MIRT824562	hsa-miR-934	CLIP-seq
MIRT824563	hsa-miR-140-3p	CLIP-seq
MIRT824564	hsa-miR-1915	CLIP-seq
MIRT824565	hsa-miR-3155	CLIP-seq
MIRT824566	hsa-miR-3155b	CLIP-seq
MIRT824567	hsa-miR-4275	CLIP-seq
MIRT824568	hsa-miR-4726-3p	CLIP-seq
MIRT824569	hsa-miR-483-3p	CLIP-seq
MIRT824570	hsa-miR-484	CLIP-seq
MIRT824571	hsa-miR-628-5p	CLIP-seq
MIRT1943726	hsa-miR-1324	CLIP-seq
MIRT1943727	hsa-miR-3151	CLIP-seq
MIRT1943728	hsa-miR-3166	CLIP-seq
MIRT1943729	hsa-miR-4257	CLIP-seq
MIRT824550	hsa-miR-4436a	CLIP-seq
MIRT1943730	hsa-miR-4462	CLIP-seq
MIRT1943731	hsa-miR-486-3p	CLIP-seq
MIRT824546	hsa-miR-3618	CLIP-seq
MIRT2182459	hsa-miR-425	CLIP-seq
MIRT824569	hsa-miR-483-3p	CLIP-seq
MIRT2182460	hsa-miR-603	CLIP-seq
MIRT2182461	hsa-miR-873	CLIP-seq
MIRT824562	hsa-miR-934	CLIP-seq
MIRT2486123	hsa-miR-1266	CLIP-seq
MIRT2486124	hsa-miR-1270	CLIP-seq
MIRT1943726	hsa-miR-1324	CLIP-seq
MIRT824563	hsa-miR-140-3p	CLIP-seq
MIRT824541	hsa-miR-150	CLIP-seq
MIRT824542	hsa-miR-1914	CLIP-seq
MIRT1943727	hsa-miR-3151	CLIP-seq
MIRT1943728	hsa-miR-3166	CLIP-seq
MIRT2486125	hsa-miR-3187-3p	CLIP-seq
MIRT824544	hsa-miR-329	CLIP-seq
MIRT824545	hsa-miR-335	CLIP-seq
MIRT824546	hsa-miR-3618	CLIP-seq
MIRT824547	hsa-miR-362-3p	CLIP-seq
MIRT2486126	hsa-miR-3677-3p	CLIP-seq
MIRT1943729	hsa-miR-4257	CLIP-seq
MIRT2486127	hsa-miR-4283	CLIP-seq
MIRT2486128	hsa-miR-432	CLIP-seq
MIRT824550	hsa-miR-4436a	CLIP-seq
MIRT1943730	hsa-miR-4462	CLIP-seq
MIRT2486129	hsa-miR-4489	CLIP-seq
MIRT2486130	hsa-miR-4518	CLIP-seq
MIRT2486131	hsa-miR-4522	CLIP-seq
MIRT2486132	hsa-miR-4529-5p	CLIP-seq
MIRT2486133	hsa-miR-4531	CLIP-seq
MIRT824552	hsa-miR-4670-5p	CLIP-seq
MIRT2486134	hsa-miR-4760-3p	CLIP-seq
MIRT2486135	hsa-miR-4777-3p	CLIP-seq
MIRT824569	hsa-miR-483-3p	CLIP-seq
MIRT1943731	hsa-miR-486-3p	CLIP-seq
MIRT824560	hsa-miR-550a	CLIP-seq
MIRT2486136	hsa-miR-620	CLIP-seq
MIRT2486137	hsa-miR-664	CLIP-seq
MIRT824562	hsa-miR-934	CLIP-seq
MIRT1943726	hsa-miR-1324	CLIP-seq
MIRT824541	hsa-miR-150	CLIP-seq
MIRT824542	hsa-miR-1914	CLIP-seq
MIRT1943727	hsa-miR-3151	CLIP-seq
MIRT1943728	hsa-miR-3166	CLIP-seq
MIRT824544	hsa-miR-329	CLIP-seq
MIRT824545	hsa-miR-335	CLIP-seq
MIRT824546	hsa-miR-3618	CLIP-seq
MIRT824547	hsa-miR-362-3p	CLIP-seq
MIRT1943729	hsa-miR-4257	CLIP-seq
MIRT824550	hsa-miR-4436a	CLIP-seq
MIRT824552	hsa-miR-4670-5p	CLIP-seq
MIRT1943731	hsa-miR-486-3p	CLIP-seq
MIRT824560	hsa-miR-550a	CLIP-seq
MIRT824562	hsa-miR-934	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	NAS	29374058
GO:0003676	Function	Nucleic acid binding	NAS	18559093
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	25593309
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	NAS	29374058
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	29374058
GO:0008284	Process	Positive regulation of cell population proliferation	NAS	29374058
GO:0016514	Component	SWI/SNF complex	IDA	23644491, 29374058
GO:0045596	Process	Negative regulation of cell differentiation	NAS	30510198
GO:0140288	Component	GBAF complex	NAS	29374058
GO:0140566	Function	Histone reader activity	IBA
GO:0140566	Function	Histone reader activity	IDA	22464331
GO:1902459	Process	Positive regulation of stem cell population maintenance	NAS	30510198

MIM	HGNC	e!Ensembl
618465	25818	ENSG00000028310

Q9H8M2

Protein name

Bromodomain-containing protein 9 (Rhabdomyosarcoma antigen MU-RMS-40.8)

Protein function

Plays a role in chromatin remodeling and regulation of transcription (PubMed:22464331, PubMed:26365797). Acts as a chromatin reader that recognizes and binds acylated histones: binds histones that are acetylated and/or butyrylated (PubMed:263657

PDB

3HME , 4NQN , 4UIT , 4UIU , 4UIV , 4UIW , 4XY8 , 4YY4 , 4YY6 , 4YYD , 4YYG , 4YYH , 4YYI , 4YYJ , 4YYK , 4Z6H , 4Z6I , 5E9V , 5EU1 , 5F1H , 5F1L , 5F25 , 5F2P , 5I40 , 5I7X , 5I7Y , 5IGM , 5IGN , 5JI8 , 5MKY , 5TWX , 6BQA , 6HM0 , 6UZF , 6V0S , 6V0X , 6V14 , 6V1B , 6Y7H , 6Y7I , 6Y7J , 6Y7K , 6Y7L , 6YQR , 6YQS , 6YQW , 8A7I , 8AHC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00439	Bromodomain	142 → 228	Bromodomain	Domain
PF12024	DUF3512	286 → 465	Domain of unknown function (DUF3512)	Family

Sequence

MGKKHKKHKAEWRSSYEDYADKPLEKPLKLVLKVGGSEVTELSGSGHDSSYYDDRSDHER
ERHKEKKKKKKKKSEKEKHLDDEERRKRKEEKKRKREREHCDTEGEADDFDPGKKVEVEP
PPDRPVRACRTQPAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHP
MDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQ
AALLGNEDTAVEEPVPEVVPVQVETAKKSKKPSREVISCMFEPEGNACSLTDSTAEEHVL
ALVEHAADEARDRINRFLPGGKMGYLKRNGDGSLLYSVVNTAEPDADEEETHPVDLSSLS
SKLLPGFTTLGFKDERRNKVTFLSSATTALSMQNNSVFGDLKSDEMELLYSAYGDETGVQ
CALSLQEFVKDAGSYSKKVVDDLLDQITGGDHSRTLFQLKQRRNVPMKPPDEAKVGDTLG
DSSSSVLEFMSMKSYPDVSVDISMLSSLGKVKKELDPDDSHLNLDETTKLLQDLHEAQAE
RGGSRPSSNLSSLSNASERDQHHLGSPSRLSVGEQPDVTHDPYEFLQSPEPAASAKT

Sequence length

597

Interactions

View interactions

	KEGG
	ATP-dependent chromatin remodeling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEZARY SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (35)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenoma	Associate	29575536	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Associate	36918560	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bisphosphonate Associated Osteonecrosis of the Jaw	Associate	36918560	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Associate	36918560	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	32276436, 37870468	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis Cutis	Stimulate	34944438	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	29575536, 38255982	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	34415102, 38303608	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	34415102	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Associate	35778964	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	35778964, 36297001	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Associate	36918560	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Autoinflammatory Diseases	Associate	34397140	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	35853853	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Stimulate	38255982	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Stimulate	35883603	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	31000698, 35853853	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	31000698, 34415102, 35853853, 38126767	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	29981437	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	38070581, 38303608	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Associate	38070581	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	35853853, 36780189	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	29575536, 30397315, 31504061, 34415102, 37870468, 38070581, 38126767	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	38303608	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms Squamous Cell	Associate	34415102	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplastic Syndromes Hereditary	Associate	32276436	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Stimulate	34944438	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Associate	35778964	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Associate	31015438	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Associate	35853853	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Inhibit	30397315	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Associate	30431433	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Associate	32065787	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Associate	31000582	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	18559093	★★★★★ ★☆☆☆☆ Found in Text Mining only

BRD9 (bromodomain containing 9)