Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6591
Gene name Gene Name - the full gene name approved by the HGNC.
Snail family transcriptional repressor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SNAI2
Synonyms (NCBI Gene) Gene synonyms aliases
SLUG, SLUGH, SLUGH1, SNAIL2, WS2D
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q11.21
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. T
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT003273 hsa-miR-204-5p Luciferase reporter assay 20056717
MIRT003273 hsa-miR-204-5p Luciferase reporter assay 20056717
MIRT003273 hsa-miR-204-5p Luciferase reporter assay 20056717
MIRT002716 hsa-miR-124-3p Microarray 15685193
MIRT002716 hsa-miR-124-3p Luciferase reporter assay 22253443
Transcription factors
Transcription factor Regulation Reference
CREB1 Repression 15955695
ESRRA Repression 15955695
EZH2 Repression 23836662
HDAC1 Repression 18588516
HDAC2 Repression 23836662
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 10866665, 11912130, 15737616, 16707493
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 17984306, 18663143
GO:0000785 Component Chromatin IDA 16707493, 19756381
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 11912130
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602150 11094 ENSG00000019549
Protein
UniProt ID O43623
Protein name Zinc finger protein SNAI2 (Neural crest transcription factor Slug) (Protein snail homolog 2)
Protein function Transcriptional repressor that modulates both activator-dependent and basal transcription. Involved in the generation and migration of neural crest cells. Plays a role in mediating RAF1-induced transcriptional repression of the TJ protein, occlu
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 128 150 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 159 181 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 185 207 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 213 235 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 241 262 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in most adult human tissues, including spleen, thymus, prostate, testis, ovary, small intestine, colon, heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Not detected in peripheral blood leukocyte. Ex
Sequence
MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWT
TAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDP
HAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRT
H
TLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKK
YQCKNCSKTFSRMSLLHKHEESGCCVAH
Sequence length 268
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Hippo signaling pathway
Adherens junction
  Regulation of PTEN gene transcription
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Neuroblastoma Neuroblastoma Loss of SNAI2 function reduces self-renewal, 3D invasion as well as metastatic spread in vivo, while strongly sensitizing neuroblastoma cells to RA-induced growth inhibition. 31862304 CBGDA
Piebaldism piebaldism N/A N/A ClinVar
Waardenburg Syndrome Waardenburg syndrome type 2D, Waardenburg syndrome N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
AA amyloidosis Associate 38016947
Adenocarcinoma Associate 18286686, 25120788, 27191723
Adenocarcinoma Mucinous Associate 32840168
Adenocarcinoma of Lung Associate 25120788, 27486982, 30321617, 31970942, 33021972, 36071042
Adenoma Pleomorphic Associate 35145202
Adenomyosis Stimulate 26307032
Alveolar Bone Loss Associate 34663464
Alzheimer Disease Stimulate 38016947
Anophthalmia with pulmonary hypoplasia Associate 37832352
Arthritis Rheumatoid Associate 20418652