Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6586
Gene name Gene Name - the full gene name approved by the HGNC.	Slit guidance ligand 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLIT3
Synonyms (NCBI Gene) Gene synonyms aliases	MEGF5, SLIL2, SLIT1, Slit-3, slit2
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q34-q35.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is secreted, likely interacting with roundabout homolog receptors to effect cell migration. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2012]

Show/Hide all(19)

miRTarBase ID	miRNA	Experiments	Reference
MIRT053057	hsa-miR-218-2-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	23720784
MIRT2109754	hsa-miR-362-5p	CLIP-seq
MIRT2109755	hsa-miR-500b	CLIP-seq
MIRT2109756	hsa-miR-501-5p	CLIP-seq
MIRT2333092	hsa-miR-3667-3p	CLIP-seq
MIRT2333093	hsa-miR-4724-3p	CLIP-seq
MIRT2333094	hsa-miR-4778-3p	CLIP-seq
MIRT2433308	hsa-miR-129-5p	CLIP-seq
MIRT2433309	hsa-miR-3168	CLIP-seq
MIRT2433310	hsa-miR-338-5p	CLIP-seq
MIRT2333094	hsa-miR-4778-3p	CLIP-seq
MIRT2433311	hsa-miR-548c-3p	CLIP-seq
MIRT2433312	hsa-miR-889	CLIP-seq
MIRT2459958	hsa-miR-1289	CLIP-seq
MIRT2459959	hsa-miR-3135b	CLIP-seq
MIRT2459960	hsa-miR-3198	CLIP-seq
MIRT2459961	hsa-miR-320e	CLIP-seq
MIRT2459962	hsa-miR-4294	CLIP-seq
MIRT2459963	hsa-miR-4309	CLIP-seq

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003180	Process	Aortic valve morphogenesis	ISS
GO:0003181	Process	Atrioventricular valve morphogenesis	ISS
GO:0005509	Function	Calcium ion binding	NAS	9813312
GO:0005615	Component	Extracellular space	IDA	19741192
GO:0005739	Component	Mitochondrion	NAS	11443047
GO:0007411	Process	Axon guidance	IBA	21873635
GO:0007411	Process	Axon guidance	IDA	11748139
GO:0008201	Function	Heparin binding	IBA	21873635
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0021834	Process	Chemorepulsion involved in embryonic olfactory bulb interneuron precursor migration	IDA	11748139
GO:0030308	Process	Negative regulation of cell growth	IMP	18829537
GO:0032870	Process	Cellular response to hormone stimulus	IEP	18566128
GO:0035385	Process	Roundabout signaling pathway	IMP	18829537
GO:0048495	Function	Roundabout binding	IBA	21873635
GO:0048495	Function	Roundabout binding	IPI	15207848
GO:0048846	Process	Axon extension involved in axon guidance	IDA	16840550
GO:0050919	Process	Negative chemotaxis	IBA	21873635
GO:0050919	Process	Negative chemotaxis	IDA	11748139
GO:0051414	Process	Response to cortisol	IEP	18566128
GO:0060412	Process	Ventricular septum morphogenesis	ISS
GO:0061364	Process	Apoptotic process involved in luteolysis	IEP	18566128
GO:0070100	Process	Negative regulation of chemokine-mediated signaling pathway	IMP	18829537

MIM	HGNC	e!Ensembl
603745	11087	ENSG00000184347

Protein

UniProt ID

O75094

Protein name

Slit homolog 3 protein (Slit-3) (Multiple epidermal growth factor-like domains protein 5) (Multiple EGF-like domains protein 5)

Protein function

May act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01462	LRRNT	33 → 60	Leucine rich repeat N-terminal domain	Family
PF13855	LRR_8	61 → 121	Leucine rich repeat	Repeat
PF13855	LRR_8	109 → 169	Leucine rich repeat	Repeat
PF13855	LRR_8	157 → 217	Leucine rich repeat	Repeat
PF01463	LRRCT	239 → 264	Leucine rich repeat C-terminal domain	Family
PF01462	LRRNT	279 → 306	Leucine rich repeat N-terminal domain	Family
PF13855	LRR_8	307 → 367	Leucine rich repeat	Repeat
PF13855	LRR_8	331 → 391	Leucine rich repeat	Repeat
PF01463	LRRCT	461 → 486	Leucine rich repeat C-terminal domain	Family
PF13855	LRR_8	532 → 593	Leucine rich repeat	Repeat
PF13855	LRR_8	581 → 641	Leucine rich repeat	Repeat
PF13855	LRR_8	605 → 665	Leucine rich repeat	Repeat
PF01463	LRRCT	687 → 712	Leucine rich repeat C-terminal domain	Family
PF01462	LRRNT	724 → 751	Leucine rich repeat N-terminal domain	Family
PF13855	LRR_8	752 → 811	Leucine rich repeat	Repeat
PF13855	LRR_8	799 → 859	Leucine rich repeat	Repeat
PF01463	LRRCT	881 → 906	Leucine rich repeat C-terminal domain	Family
PF12661	hEGF	925 → 944	Human growth factor-like EGF	Domain
PF00008	EGF	959 → 992	EGF-like domain	Domain
PF00008	EGF	1000 → 1030	EGF-like domain	Domain
PF00008	EGF	1038 → 1070	EGF-like domain	Domain
PF00008	EGF	1078 → 1108	EGF-like domain	Domain
PF00008	EGF	1123 → 1153	EGF-like domain	Domain
PF02210	Laminin_G_2	1186 → 1314	Laminin G domain	Domain
PF00008	EGF	1371 → 1401	EGF-like domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in thyroid. {ECO:0000269|PubMed:9813312}.

Sequence

MAPGWAGVGAAVRARLALALALASVLSGPPAVACPTKCTCSAASVDCHGLGLRAVPRGIP
RNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNK
LQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRAL
RDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTVGQFT
LCMAPVHLRGFNVADVQKKEYVCPAPHSEPPSCNANSISCPSPCTCSNNIVDCRGKGLME
IPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSL
VLYGNKITEIVKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISK
GLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKS
KKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLN
DNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRV
FRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINL
LSNPFNCNCHLAWLGKWLRKRRIVSGNPRCQKPFFLKEIPIQDVAIQDFTCDGNEESSCQ
LSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAVPRELSALRHLTLI
DLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPE
GSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPT
HRFQCKGPVDINIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCI
QNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVC
ICPPNYTGELCDEVIDHCVPELNLCQHEAKCIPLDKGFSCECVPGYSGKLCETDNDDCVA
HKCRHGAQCVDTINGYTCTCPQGFSGPFCEHPPPMVLLQTSPCDQYECQNGAQCIVVQQE
PTCRCPPGFAGPRCEKLITVNFVGKDSYVELASAKVRPQANISLQVATDKDNGILLYKGD
NDPLALELYQGHVRLVYDSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPK
SLGKLQKQPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKA
LPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHG
KCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSG
EHCQQENPCLGQVVREVIRRQKGYASCATASKVPIMECRGGCGPQCCQPTRSKRRKYVFQ
CTDGSSFVEEVERHLECGCLACS

Sequence length

1523

Interactions

View interactions

	KEGG		Reactome
	Axon guidance		Signaling by ROBO receptors

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Atrial fibrillation	Atrial Fibrillation	rs120074192, rs121908590, rs121908593, rs121434558, rs587776851, rs387906612, rs387906613, rs387906614, rs387906615, rs199472687, rs199472705, rs199473324, rs587777336, rs587777339, rs587777557 View all (6 more)	30061737, 29892015
Psoriasis	Psoriasis	rs281875215, rs587777763, rs281875213, rs281875212	25574825
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	15231749

Show/Hide Unknown Diseases (6)

Disease term	Disease name	References	Source
Unknown
Mental depression	Unipolar Depression, Major Depressive Disorder	21152026	ClinVar
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	29892015, 30061737	ClinVar
Atrial Fibrillation	Atrial Fibrillation		GWAS
Bipolar Disorder	Bipolar Disorder		GWAS
Multiple Sclerosis	Multiple Sclerosis		GWAS
Ischemic Stroke	Ischemic Stroke		GWAS

Show/Hide Text Mining Associations (36)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Inhibit	36752296
Adenoma	Associate	24516561, 27896617
Arthritis Rheumatoid	Associate	20298552
Bicuspid Aortic Valve Disease	Associate	36071494
Bipolar Disorder	Associate	27112568
Breast Neoplasms	Associate	15534609, 36361532, 37178414
Carcinoma Hepatocellular	Associate	19114000
Carcinoma Non Small Cell Lung	Associate	26632718
Carcinoma Squamous Cell	Associate	29568882, 36451444
Colonic Neoplasms	Inhibit	35034539
Colorectal Neoplasms	Associate	15534609, 24294377, 24516561, 26291085, 27462788
Death	Associate	26632718
Diabetes Mellitus Type 2	Associate	37680885
Diabetic Nephropathies	Associate	37063851
Essential Tremor	Associate	31404076
Gallbladder Neoplasms	Associate	40527859
Gestational Weight Gain	Associate	37513594
Glioblastoma	Associate	24158112
Glioma	Associate	15534609, 24158112, 25569436
Hodgkin Disease	Associate	25569436
Leukemia Myeloid Acute	Associate	30820596
Lung Diseases	Associate	15534609
Lung Neoplasms	Associate	20838434
Lymphoma	Associate	25569436
Muscular Dystrophy Duchenne	Associate	32762475
Neoplasms	Associate	15534609, 26291085, 30662333, 36361532
Neoplastic Syndromes Hereditary	Associate	31404076
Obesity	Associate	37513594
Osteoporosis	Associate	32762475
Ovarian Neoplasms	Associate	21465248, 28407786
Ovarian Neoplasms	Inhibit	22132142
Pregnancy Ectopic	Associate	36793891
Respiratory Tract Infections	Associate	30662333
Urethral Neoplasms	Inhibit	30662333
Uterine Cervical Neoplasms	Associate	16700909
Vascular System Injuries	Associate	36793891

SLIT3 (slit guidance ligand 3)