Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6583
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 22 member 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC22A4
Synonyms (NCBI Gene) Gene synonyms aliases	DFNB60, ETTh, OCTN1
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q31.1
Summary Summary of gene provided in NCBI Entrez Gene.	Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The encoded protein is an organic c

Show/Hide all(112)

miRTarBase ID	miRNA	Experiments	Reference
MIRT614650	hsa-miR-8485	HITS-CLIP	23824327
MIRT614649	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT614648	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT614647	hsa-miR-603	HITS-CLIP	23824327
MIRT614646	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT627112	hsa-miR-6879-3p	HITS-CLIP	23824327
MIRT614645	hsa-miR-6755-3p	HITS-CLIP	23824327
MIRT614644	hsa-miR-3941	HITS-CLIP	23824327
MIRT614650	hsa-miR-8485	HITS-CLIP	23824327
MIRT614649	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT614648	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT614647	hsa-miR-603	HITS-CLIP	23824327
MIRT614646	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT627112	hsa-miR-6879-3p	HITS-CLIP	23824327
MIRT614645	hsa-miR-6755-3p	HITS-CLIP	23824327
MIRT614644	hsa-miR-3941	HITS-CLIP	23824327
MIRT614650	hsa-miR-8485	HITS-CLIP	23824327
MIRT614649	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT614648	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT614647	hsa-miR-603	HITS-CLIP	23824327
MIRT614646	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT627112	hsa-miR-6879-3p	HITS-CLIP	23824327
MIRT614645	hsa-miR-6755-3p	HITS-CLIP	23824327
MIRT614644	hsa-miR-3941	HITS-CLIP	23824327
MIRT614650	hsa-miR-8485	HITS-CLIP	23824327
MIRT614649	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT614648	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT614647	hsa-miR-603	HITS-CLIP	23824327
MIRT614646	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT627112	hsa-miR-6879-3p	HITS-CLIP	23824327
MIRT614645	hsa-miR-6755-3p	HITS-CLIP	23824327
MIRT614644	hsa-miR-3941	HITS-CLIP	23824327
MIRT614650	hsa-miR-8485	HITS-CLIP	23824327
MIRT614649	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT614648	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT614647	hsa-miR-603	HITS-CLIP	23824327
MIRT614646	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT614645	hsa-miR-6755-3p	HITS-CLIP	23824327
MIRT614644	hsa-miR-3941	HITS-CLIP	23824327
MIRT614650	hsa-miR-8485	HITS-CLIP	23824327
MIRT614649	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT614648	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT614647	hsa-miR-603	HITS-CLIP	23824327
MIRT614646	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT627112	hsa-miR-6879-3p	HITS-CLIP	23824327
MIRT614645	hsa-miR-6755-3p	HITS-CLIP	23824327
MIRT614644	hsa-miR-3941	HITS-CLIP	23824327
MIRT614650	hsa-miR-8485	HITS-CLIP	23824327
MIRT614649	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT614648	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT614647	hsa-miR-603	HITS-CLIP	23824327
MIRT614646	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT627112	hsa-miR-6879-3p	HITS-CLIP	23824327
MIRT614645	hsa-miR-6755-3p	HITS-CLIP	23824327
MIRT614644	hsa-miR-3941	HITS-CLIP	23824327
MIRT614650	hsa-miR-8485	HITS-CLIP	23824327
MIRT614649	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT614648	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT614647	hsa-miR-603	HITS-CLIP	23824327
MIRT614646	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT627112	hsa-miR-6879-3p	HITS-CLIP	23824327
MIRT614645	hsa-miR-6755-3p	HITS-CLIP	23824327
MIRT614644	hsa-miR-3941	HITS-CLIP	23824327
MIRT614650	hsa-miR-8485	HITS-CLIP	23824327
MIRT614649	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT614648	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT614647	hsa-miR-603	HITS-CLIP	23824327
MIRT614646	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT627112	hsa-miR-6879-3p	HITS-CLIP	23824327
MIRT614645	hsa-miR-6755-3p	HITS-CLIP	23824327
MIRT614644	hsa-miR-3941	HITS-CLIP	23824327
MIRT614650	hsa-miR-8485	HITS-CLIP	23824327
MIRT614649	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT614648	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT614647	hsa-miR-603	HITS-CLIP	23824327
MIRT614646	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT614645	hsa-miR-6755-3p	HITS-CLIP	23824327
MIRT614644	hsa-miR-3941	HITS-CLIP	23824327
MIRT1354527	hsa-miR-1182	CLIP-seq
MIRT1354528	hsa-miR-1292	CLIP-seq
MIRT1354529	hsa-miR-193a-5p	CLIP-seq
MIRT1354530	hsa-miR-4276	CLIP-seq
MIRT1354531	hsa-miR-4471	CLIP-seq
MIRT1354532	hsa-miR-515-5p	CLIP-seq
MIRT1354528	hsa-miR-1292	CLIP-seq
MIRT1354530	hsa-miR-4276	CLIP-seq
MIRT1354531	hsa-miR-4471	CLIP-seq
MIRT1354528	hsa-miR-1292	CLIP-seq
MIRT1354530	hsa-miR-4276	CLIP-seq
MIRT1354531	hsa-miR-4471	CLIP-seq
MIRT2623859	hsa-miR-1251	CLIP-seq
MIRT2623860	hsa-miR-1305	CLIP-seq
MIRT2623861	hsa-miR-3173-3p	CLIP-seq
MIRT2623862	hsa-miR-3617	CLIP-seq
MIRT2623863	hsa-miR-4307	CLIP-seq
MIRT2623864	hsa-miR-4422	CLIP-seq
MIRT2623865	hsa-miR-4428	CLIP-seq
MIRT2623866	hsa-miR-4452	CLIP-seq
MIRT2623867	hsa-miR-498	CLIP-seq
MIRT2623868	hsa-miR-522	CLIP-seq
MIRT2623869	hsa-miR-641	CLIP-seq
MIRT2623859	hsa-miR-1251	CLIP-seq
MIRT2623860	hsa-miR-1305	CLIP-seq
MIRT2623861	hsa-miR-3173-3p	CLIP-seq
MIRT2623862	hsa-miR-3617	CLIP-seq
MIRT2623863	hsa-miR-4307	CLIP-seq
MIRT2623864	hsa-miR-4422	CLIP-seq
MIRT2623865	hsa-miR-4428	CLIP-seq
MIRT2623866	hsa-miR-4452	CLIP-seq
MIRT2623867	hsa-miR-498	CLIP-seq
MIRT2623868	hsa-miR-522	CLIP-seq
MIRT2623869	hsa-miR-641	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
RUNX1	Unknown	15184985;17142562;18328148

Show/Hide all(27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	TAS	9426230
GO:0005515	Function	Protein binding	IPI	15523054
GO:0005524	Function	ATP binding	IEA
GO:0005739	Component	Mitochondrion	IDA	16729965
GO:0005886	Component	Plasma membrane	IC	9426230
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	9426230
GO:0006641	Process	Triglyceride metabolic process	IEA
GO:0006814	Process	Sodium ion transport	IEA
GO:0007589	Process	Body fluid secretion	TAS	9426230
GO:0008513	Function	Secondary active organic cation transmembrane transporter activity	TAS
GO:0009437	Process	Carnitine metabolic process	IEA
GO:0015171	Function	Amino acid transmembrane transporter activity	IDA	23567998
GO:0015226	Function	Carnitine transmembrane transporter activity	IDA	16729965
GO:0015293	Function	Symporter activity	IEA
GO:0015491	Function	Cation:cation antiporter activity	IDA	9426230
GO:0015651	Function	Quaternary ammonium group transmembrane transporter activity	IBA	21873635
GO:0015651	Function	Quaternary ammonium group transmembrane transporter activity	IDA	9426230, 23567998
GO:0015695	Process	Organic cation transport	TAS	9426230
GO:0015697	Process	Quaternary ammonium group transport	IBA	21873635
GO:0015697	Process	Quaternary ammonium group transport	IDA	9426230, 23567998
GO:0015879	Process	Carnitine transport	IDA	16729965
GO:0016324	Component	Apical plasma membrane	IDA	18641280
GO:0030165	Function	PDZ domain binding	IPI	15523054
GO:0042908	Process	Xenobiotic transport	IDA	23567998
GO:0089718	Process	Amino acid import across plasma membrane	IDA	23567998
GO:1902603	Process	Carnitine transmembrane transport	IEA

MIM	HGNC	e!Ensembl
604190	10968	ENSG00000197208

Protein

UniProt ID

Q9H015

Protein name

Solute carrier family 22 member 4 (Ergothioneine transporter) (ET transporter) (ETTh) (Organic cation/carnitine transporter 1) (OCTN1)

Protein function

Transporter that mediates the transport of endogenous and microbial zwitterions and organic cations (PubMed:10215651, PubMed:15107849, PubMed:15795384, PubMed:16729965, PubMed:20601551, PubMed:22206629, PubMed:22569296, PubMed:29530864). Functio

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00083	Sugar_tr	107 → 522	Sugar (and other) transporter	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed (PubMed:9426230). Highly expressed in kidney, trachea, ileum, bone marrow and whole blood (PubMed:15795384, PubMed:9426230). Expressed in small intestines (PubMed:20601551). Weakly expressed in skeletal muscle, prostat

Sequence

MRDYDEVIAFLGEWGPFQRLIFFLLSASIIPNGFNGMSVVFLAGTPEHRCRVPDAANLSS
AWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFS
QDVYLSTVVTEWNLVCEDNWKVPLTTSLFFVGVLLGSFVSGQLSDRFGRKNVLFATMAVQ
TGFSFLQIFSISWEMFTVLFVIVGMGQISNYVVAFILGTEILGKSVRIIFSTLGVCTFFA
VGYMLLPLFAYFIRDWRMLLLALTVPGVLCVPLWWFIPESPRWLISQRRFREAEDIIQKA
AKMNNIAVPAVIFDSVEELNPLKQQKAFILDLFRTRNIAIMTIMSLLLWMLTSVGYFALS
LDAPNLHGDAYLNCFLSALIEIPAYITAWLLLRTLPRRYIIAAVLFWGGGVLLFIQLVPV
DYYFLSIGLVMLGKFGITSAFSMLYVFTAELYPTLVRNMAVGVTSTASRVGSIIAPYFVY
LGAYNRMLPYIVMGSLTVLIGILTLFFPESLGMTLPETLEQMQKVKWFRSGKKTRDSMET
EENPKVLITAF

Sequence length

551

Interactions

View interactions

	KEGG		Reactome
	Choline metabolism in cancer		Organic cation transport

Show/Hide Causal Diseases (6)

Disease term	Disease name	dbSNP ID	References
Causal
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	29059683
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs1555800701, rs1215189537	23202125, 29212778
Inflammatory bowel disease	Inflammatory Bowel Diseases	rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs1989014468	26192919
Myocarditis	Myocarditis	rs28763965	21641380
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	24816252
Vasculitis	Vasculitis	rs376785840, rs587777240, rs200930463, rs587777241, rs77563738, rs202134424, rs148936893, rs587777242, rs775440641, rs770689762, rs45511697, rs139750129, rs756881285, rs747774101, rs1568966771 View all (6 more)

Show/Hide Unknown Diseases (7)

Disease term	Disease name	Evidence	References	Source
Unknown
Crohn disease	Crohn Disease		17804789	ClinVar
Nasal polyposis	Nasal polyposis			GWAS
Breast cancer	Breast cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients		GWAS, CBGDA
Myocardial Infarction	Myocardial Infarction			GWAS
Acne	Acne			GWAS
Inflammatory Bowel Disease	Inflammatory Bowel Disease			GWAS
Psoriasis	Psoriasis			GWAS

Show/Hide Text Mining Associations (35)

Disease Name	Relationship Type	References
Associations from Text Mining
Arthritis Rheumatoid	Associate	15693005, 15751072, 16255050, 16484987, 16796743, 25707686, 26329403
Asthma	Associate	16519819
Autoimmune Diseases	Associate	16249223, 16796743, 26329403
Cerebral Infarction	Associate	35962388
Chronic Disease	Associate	20031577
Colitis Ulcerative	Associate	16469794, 39328405
Colonic Diseases	Associate	21079743
COVID 19	Associate	38538269
Crohn Disease	Associate	15693005, 16255050, 16361305, 16437728, 16469794, 16484987, 16796743, 17006998, 17451203, 17786191, 18614543, 18715515, 20031577, 21816865, 22206629, 22411504, 26329403 View all (2 more)
Diabetes Mellitus Type 1	Associate	16796743
Diabetes Mellitus Type 2	Associate	36528847
Graves Disease	Associate	16519819
Hearing Loss	Associate	34194829
Heart Failure	Associate	29901123
Ige Responsiveness Atopic	Associate	16519819
Inflammation	Associate	18433468, 29678179, 32964310
Inflammatory Bowel Disease 5	Associate	22440928
Inflammatory Bowel Diseases	Associate	16469794, 23474282, 25314644
Intracranial Aneurysm	Associate	39181687
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	28420426, 32027818
Leukemia Myeloid Acute	Associate	32905646
Lung Diseases	Associate	29678179
Lupus Erythematosus Systemic	Associate	16519819
Mucocutaneous Lymph Node Syndrome	Associate	40457357
Multiple Sclerosis	Associate	16519819
Neoplasms	Associate	9426230
Neoplasms Adipose Tissue	Associate	32964310
Polycythemia Vera	Associate	33677043
Psoriasis	Associate	16519819, 18614543, 26613086
Pulmonary Disease Chronic Obstructive	Associate	29678179
Renal Insufficiency Chronic	Associate	29153133
Sleep Deprivation	Associate	38538269
Tooth Erosion	Associate	25707686
Tooth Loss	Associate	32964310
Torsades de Pointes	Associate	19528813

SLC22A4 (solute carrier family 22 member 4)