Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6582
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 22 member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC22A2
Synonyms (NCBI Gene) Gene synonyms aliases	Oct-02
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6q25.3
Summary Summary of gene provided in NCBI Entrez Gene.	Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar c

Show/Hide all(14)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017635	hsa-miR-335-5p	Microarray	18185580
MIRT1354399	hsa-miR-3152-3p	CLIP-seq
MIRT1354400	hsa-miR-4724-5p	CLIP-seq
MIRT1354401	hsa-miR-4766-5p	CLIP-seq
MIRT1354402	hsa-miR-488	CLIP-seq
MIRT1354399	hsa-miR-3152-3p	CLIP-seq
MIRT2104826	hsa-miR-3622a-3p	CLIP-seq
MIRT2104827	hsa-miR-3622b-3p	CLIP-seq
MIRT2104828	hsa-miR-412	CLIP-seq
MIRT2104829	hsa-miR-4282	CLIP-seq
MIRT2104830	hsa-miR-4659a-3p	CLIP-seq
MIRT2104831	hsa-miR-4659b-3p	CLIP-seq
MIRT1354400	hsa-miR-4724-5p	CLIP-seq
MIRT2104832	hsa-miR-513a-3p	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
USF1	Activation	17314196
USF1	Unknown	18508876

Show/Hide all(98)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005275	Function	Amine transmembrane transporter activity	IDA	9687576
GO:0005277	Function	Acetylcholine transmembrane transporter activity	IDA	15817714
GO:0005326	Function	Neurotransmitter transmembrane transporter activity	IDA	9687576, 16581093
GO:0005326	Function	Neurotransmitter transmembrane transporter activity	TAS
GO:0005886	Component	Plasma membrane	IDA	23137377
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9260930
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006812	Process	Monoatomic cation transport	IEA
GO:0006836	Process	Neurotransmitter transport	IDA	9687576
GO:0006836	Process	Neurotransmitter transport	TAS
GO:0006837	Process	Serotonin transport	IDA	9687576, 16581093
GO:0007589	Process	Body fluid secretion	TAS	9260930
GO:0008504	Function	Monoamine transmembrane transporter activity	IDA	9687576, 12089365, 15212162, 16581093, 17072098, 17460754
GO:0008504	Function	Monoamine transmembrane transporter activity	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	IDA	11907186
GO:0009925	Component	Basal plasma membrane	IDA	35307651
GO:0009925	Component	Basal plasma membrane	IEA
GO:0015101	Function	Organic cation transmembrane transporter activity	EXP	19141712
GO:0015101	Function	Organic cation transmembrane transporter activity	IBA
GO:0015101	Function	Organic cation transmembrane transporter activity	IDA	9260930, 9687576, 12089365, 12538837, 16024787, 17460754, 21128598, 22806583, 24291757
GO:0015101	Function	Organic cation transmembrane transporter activity	IEA
GO:0015101	Function	Organic cation transmembrane transporter activity	IMP	23864433
GO:0015101	Function	Organic cation transmembrane transporter activity	TAS	9260930
GO:0015132	Function	Prostaglandin transmembrane transporter activity	IDA	11907186
GO:0015132	Function	Prostaglandin transmembrane transporter activity	IEA
GO:0015179	Function	L-amino acid transmembrane transporter activity	IMP	23864433
GO:0015214	Function	Pyrimidine nucleoside transmembrane transporter activity	IEA
GO:0015214	Function	Pyrimidine nucleoside transmembrane transporter activity	IMP	20477935
GO:0015220	Function	Choline transmembrane transporter activity	IDA	9687576
GO:0015234	Function	Thiamine transmembrane transporter activity	IDA	24961373
GO:0015489	Function	Putrescine transmembrane transporter activity	IDA	21128598
GO:0015489	Function	Putrescine transmembrane transporter activity	IEA
GO:0015562	Function	Efflux transmembrane transporter activity	IDA	9687576
GO:0015606	Function	Spermidine transmembrane transporter activity	ISS
GO:0015651	Function	Quaternary ammonium group transmembrane transporter activity	IDA	9260930
GO:0015695	Process	Organic cation transport	IBA
GO:0015695	Process	Organic cation transport	IDA	16024787
GO:0015695	Process	Organic cation transport	IDA	9687576, 22806583, 24291757
GO:0015695	Process	Organic cation transport	IMP	23864433
GO:0015695	Process	Organic cation transport	TAS	9260930
GO:0015697	Process	Quaternary ammonium group transport	IEA
GO:0015732	Process	Prostaglandin transport	IDA	11907186
GO:0015837	Process	Amine transport	IDA	9687576
GO:0015847	Process	Putrescine transport	IDA	21128598
GO:0015848	Process	Spermidine transport	ISS
GO:0015870	Process	Acetylcholine transport	IDA	15817714
GO:0015871	Process	Choline transport	IDA	9687576
GO:0015872	Process	Dopamine transport	IDA	16581093
GO:0015872	Process	Dopamine transport	ISS
GO:0015874	Process	Norepinephrine transport	IDA	9687576, 16581093
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9260930
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	ISS
GO:0016324	Component	Apical plasma membrane	IDA	15817714, 20477935
GO:0016324	Component	Apical plasma membrane	IEA
GO:0019534	Function	Toxin transmembrane transporter activity	IDA	9687576, 22806583, 24291757
GO:0019534	Function	Toxin transmembrane transporter activity	IEA
GO:0019534	Function	Toxin transmembrane transporter activity	IMP	20477935
GO:0019534	Function	Toxin transmembrane transporter activity	ISS	30120945
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0042908	Process	Xenobiotic transport	IDA	9687576, 22806583, 24291757
GO:0042908	Process	Xenobiotic transport	IEA
GO:0042908	Process	Xenobiotic transport	IMP	20477935
GO:0042908	Process	Xenobiotic transport	ISS	30120945
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IDA	12395288, 16394027
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IEA
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IMP	20477935
GO:0048241	Process	Epinephrine transport	IDA	16581093
GO:0048241	Process	Epinephrine transport	ISS
GO:0051608	Process	Histamine transport	IDA	16581093
GO:0051610	Process	Serotonin uptake	IDA	9687576
GO:0051610	Process	Serotonin uptake	IEA
GO:0051615	Process	Histamine uptake	IDA	9687576
GO:0051620	Process	Norepinephrine uptake	IDA	9687576
GO:0051620	Process	Norepinephrine uptake	TAS
GO:0055085	Process	Transmembrane transport	IEA
GO:0061459	Function	L-arginine transmembrane transporter activity	IMP	23864433
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0071934	Process	Thiamine transmembrane transport	IDA	24961373
GO:0071934	Process	Thiamine transmembrane transport	IEA
GO:0072530	Process	Purine-containing compound transmembrane transport	IEA
GO:0072530	Process	Purine-containing compound transmembrane transport	TAS
GO:0089718	Process	Amino acid import across plasma membrane	IMP	23864433
GO:0090494	Process	Dopamine uptake	IDA	9687576
GO:0090494	Process	Dopamine uptake	IEA
GO:0097638	Process	L-arginine import across plasma membrane	IMP	23864433
GO:0098793	Component	Presynapse	IEA
GO:0140115	Process	Export across plasma membrane	IDA	9687576
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653
GO:1902475	Process	L-alpha-amino acid transmembrane transport	IMP	23864433
GO:1903711	Process	Spermidine transmembrane transport	IEA
GO:1903826	Process	L-arginine transmembrane transport	IEA
GO:1990748	Process	Cellular detoxification	IDA	9687576, 22806583, 24291757
GO:1990748	Process	Cellular detoxification	IEA
GO:1990748	Process	Cellular detoxification	IMP	20477935
GO:1990962	Process	Xenobiotic transport across blood-brain barrier	NAS	20477935

MIM	HGNC	e!Ensembl
602608	10966	ENSG00000112499

Protein

UniProt ID

O15244

Protein name

Solute carrier family 22 member 2 (Organic cation transporter 2) (hOCT2)

Protein function

Electrogenic voltage-dependent transporter that mediates the transport of a variety of organic cations such as endogenous bioactive amines, cationic drugs and xenobiotics (PubMed:9260930, PubMed:9687576). Functions as a Na(+)-independent, bidire

PDB

8ET9

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00083	Sugar_tr	91 → 529	Sugar (and other) transporter	Family

Tissue specificity

TISSUE SPECIFICITY: Mainly expressed in kidney, in the cortex and medulla (PubMed:11912245, PubMed:12089365, PubMed:9260930). Localized in testis, mostly to peritubular myoid cells and Leydig cells and also detected along the basal membrane of Sertoli cel

Sequence

MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHRCRSPGVAELS
LRCGWSPAEELNYTVPGPGPAGEASPRQCRRYEVDWNQSTFDCVDPLASLDTNRSRLPLG
PCRDGWVYETPGSSIVTEFNLVCANSWMLDLFQSSVNVGFFIGSMSIGYIADRFGRKLCL
LTTVLINAAAGVLMAISPTYTWMLIFRLIQGLVSKAGWLIGYILITEFVGRRYRRTVGIF
YQVAYTVGLLVLAGVAYALPHWRWLQFTVSLPNFFFLLYYWCIPESPRWLISQNKNAEAM
RIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIRKHTMILMYNWFTSSV
LYQGLIMHMGLAGDNIYLDFFYSALVEFPAAFMIILTIDRIGRRYPWAASNMVAGAACLA
SVFIPGDLQWLKIIISCLGRMGITMAYEIVCLVNAELYPTFIRNLGVHICSSMCDIGGII
TPFLVYRLTNIWLELPLMVFGVLGLVAGGLVLLLPETKGKALPETIEEAENMQRPRKNKE
KMIYLQVQKLDIPLN

Sequence length

555

Interactions

View interactions

	KEGG		Reactome
	Choline metabolism in cancer		Neurotransmitter clearance Norepinephrine Neurotransmitter Release Cycle Abacavir transmembrane transport Na+/Cl- dependent neurotransmitter transporters Organic cation transport

Show/Hide Unknown Diseases (11)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Barrett esophagus	Barrett's esophagus	N/A	N/A	GWAS
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Coronary Heart Disease	Coronary heart disease	N/A	N/A	GWAS
Diabetes	Type 2 diabetes, Type 2 diabetes or prostate cancer (pleiotropy)	N/A	N/A	GWAS
Duodenal Ulcer	Duodenal ulcer	N/A	N/A	GWAS
Kidney Disease	Chronic kidney disease	N/A	N/A	GWAS
Lung adenocarcinoma	Familial squamous cell lung carcinoma	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Myocardial Infarction	Myocardial infarction	N/A	N/A	GWAS
Prostate cancer	Prostate cancer	N/A	N/A	GWAS
Urolithiasis	Urolithiasis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (17)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acute Kidney Injury	Associate	28640195, 40526606
Anxiety	Associate	30561642
Carcinoma Non Small Cell Lung	Associate	27590272
Carcinoma Pancreatic Ductal	Associate	36076515
Cardiomyopathies	Associate	37658577
Colorectal Neoplasms	Associate	20551056, 28992563
Diabetes Mellitus Type 2	Associate	20139901
Drug Related Side Effects and Adverse Reactions	Associate	23545897, 29514829
Essential Hypertension	Associate	17060063
Headache	Associate	30561642
Hearing Disorders	Associate	25823781
Hematologic Diseases	Associate	27590272
Hypertension	Associate	17060063
Lupus Erythematosus Systemic	Associate	31156624
Mental Disorders	Associate	30561642
Neoplasms	Associate	27435027
Systemic carnitine deficiency	Associate	37658577

SLC22A2 (solute carrier family 22 member 2)