Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6580
Gene name Gene Name - the full gene name approved by the HGNC.
Solute carrier family 22 member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SLC22A1
Synonyms (NCBI Gene) Gene synonyms aliases
HOCT1, OCT1, oct1_cds
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q25.3
Summary Summary of gene provided in NCBI Entrez Gene.
Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar c
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT646165 hsa-miR-6768-5p HITS-CLIP 23824327
MIRT646164 hsa-miR-6856-3p HITS-CLIP 23824327
MIRT646163 hsa-miR-4687-5p HITS-CLIP 23824327
MIRT646162 hsa-miR-4275 HITS-CLIP 23824327
MIRT646161 hsa-miR-3941 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005277 Function Acetylcholine transmembrane transporter activity IEA
GO:0005326 Function Neurotransmitter transmembrane transporter activity IDA 24688079
GO:0005330 Function Dopamine:sodium symporter activity IEA
GO:0005334 Function Norepinephrine:sodium symporter activity IEA
GO:0005515 Function Protein binding IPI 11543633, 21988832, 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602607 10963 ENSG00000175003
Protein
UniProt ID O15245
Protein name Solute carrier family 22 member 1 (Organic cation transporter 1) (hOCT1)
Protein function Electrogenic voltage-dependent transporter that mediates the transport of a variety of organic cations such as endogenous bioactive amines, cationic drugs and xenobiotics (PubMed:11388889, PubMed:11408531, PubMed:12439218, PubMed:12719534, PubMe
PDB 8ET6 , 8ET7 , 8ET8 , 8JTS , 8JTT , 8JTV , 8JTW , 8JTX , 8JTY , 8JTZ , 8JU0 , 8SC1 , 8SC2 , 8SC3 , 8SC4 , 8SC6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00083 Sugar_tr 89 371 Sugar (and other) transporter Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed with high level in liver (PubMed:11388889, PubMed:23680637, PubMed:9187257, PubMed:9260930). In liver, expressed around the central vein (PubMed:16263091). Expressed in kidney (PubMed:9187257, PubMed:9260930). Expresse
Sequence
MPTVDDILEQVGESGWFQKQAFLILCLLSAAFAPICVGIVFLGFTPDHHCQSPGVAELSQ
RCGWSPAEELNYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGP
CQDGWVYDTPGSSIVTEFNLVCADSWKLDLFQSCLNAGFLFGSLGVGYFADRFGRKLCLL
GTVLVNAVSGVLMAFSPNYMSMLLFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMY
QMAFTVGLVALTGLAYALPHWRWLQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTEAIK
IMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFILMYLWFTDSVL
YQGLILHMGAT
SGNLYLDFLYSALVEIPGAFIALITIDRVGRIYPMAMSNLLAGAACLVM
IFISPDLHWLNIIIMCVGRMGITIAIQMICLVNAELYPTFVRNLGVMVCSSLCDIGGIIT
PFIVFRLREVWQALPLILFAVLGLLAAGVTLLLPETKGVALPETMKDAENLGRKAKPKEN
TIYLKVQTSEPSGT
Sequence length 554
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Bile secretion
Choline metabolism in cancer
  Neurotransmitter clearance
Norepinephrine Neurotransmitter Release Cycle
Abacavir transmembrane transport
Na+/Cl- dependent neurotransmitter transporters
Organic cation transport
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Colonic neoplasms Malignant tumor of colon, Colonic Neoplasms rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483 15059925
Kidney disease Chronic Kidney Diseases rs74315342, rs749740335, rs757649673, rs112417755, rs35138315 29545352
Leukemia Leukemia, Myelocytic, Acute rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 27903959
Obesity Obesity rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562
View all (27 more)
20956498
Unknown
Disease term Disease name Evidence References Source
Coronary heart disease Coronary heart disease 22319020 ClinVar
Prostate cancer Prostate cancer Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population. GWAS, CBGDA
Gout Gout GWAS
Hypertension Hypertension GWAS
Associations from Text Mining
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 15751072
Breast Neoplasms Stimulate 18550719
Burkitt Lymphoma Associate 27407111
Carcinogenesis Associate 40026294
Carcinoma Hepatocellular Associate 22439694, 26872727, 28178663, 30628708, 31953214, 36881382, 37722628
Cardiotoxicity Associate 38547766
Colonic Neoplasms Associate 35167937
Communicable Diseases Associate 35456416
Death Associate 27799064
Developmental Disabilities Associate 27799064