SLC22A1 (solute carrier family 22 member 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6580
Gene name Gene Name - the full gene name approved by the HGNC.
Solute carrier family 22 member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SLC22A1
Synonyms (NCBI Gene) Gene synonyms aliases
HOCT1, OCT1, oct1_cds
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q25.3
Summary Summary of gene provided in NCBI Entrez Gene.
Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar c
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(14)
miRTarBase ID miRNA Experiments Reference
MIRT646165 hsa-miR-6768-5p HITS-CLIP 23824327
MIRT646164 hsa-miR-6856-3p HITS-CLIP 23824327
MIRT646163 hsa-miR-4687-5p HITS-CLIP 23824327
MIRT646162 hsa-miR-4275 HITS-CLIP 23824327
MIRT646161 hsa-miR-3941 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(100)
GO ID Ontology Definition Evidence Reference
GO:0005277 Function Acetylcholine transmembrane transporter activity IDA 15817714
GO:0005277 Function Acetylcholine transmembrane transporter activity IEA
GO:0005326 Function Neurotransmitter transmembrane transporter activity IDA 12439218, 24688079, 24961373, 35469921
GO:0005326 Function Neurotransmitter transmembrane transporter activity IEA
GO:0005330 Function Dopamine:sodium symporter activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
602607 10963 ENSG00000175003
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O15245
Protein name Solute carrier family 22 member 1 (Organic cation transporter 1) (hOCT1)
Protein function Electrogenic voltage-dependent transporter that mediates the transport of a variety of organic cations such as endogenous bioactive amines, cationic drugs and xenobiotics (PubMed:11388889, PubMed:11408531, PubMed:12439218, PubMed:12719534, PubMe
PDB 8ET6 , 8ET7 , 8ET8 , 8JTS , 8JTT , 8JTV , 8JTW , 8JTX , 8JTY , 8JTZ , 8JU0 , 8SC1 , 8SC2 , 8SC3 , 8SC4 , 8SC6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00083 Sugar_tr 89 → 371 Sugar (and other) transporter Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed with high level in liver (PubMed:11388889, PubMed:23680637, PubMed:9187257, PubMed:9260930). In liver, expressed around the central vein (PubMed:16263091). Expressed in kidney (PubMed:9187257, PubMed:9260930). Expresse
Sequence 
MPTVDDILEQVGESGWFQKQAFLILCLLSAAFAPICVGIVFLGFTPDHHCQSPGVAELSQ
RCGWSPAEELNYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGP
CQDGWVYDTPGSSIVTEFNLVCADSWKLDLFQSCLNAGFLFGSLGVGYFADRFGRKLCLL
GTVLVNAVSGVLMAFSPNYMSMLLFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMY
QMAFTVGLVALTGLAYALPHWRWLQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTEAIK
IMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFILMYLWFTDSVL
YQGLILHMGATSGNLYLDFLYSALVEIPGAFIALITIDRVGRIYPMAMSNLLAGAACLVM
IFISPDLHWLNIIIMCVGRMGITIAIQMICLVNAELYPTFVRNLGVMVCSSLCDIGGIIT
PFIVFRLREVWQALPLILFAVLGLLAAGVTLLLPETKGVALPETMKDAENLGRKAKPKEN
TIYLKVQTSEPSGT
Sequence length 554
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Bile secretion
Choline metabolism in cancer 		  Neurotransmitter clearance
Norepinephrine Neurotransmitter Release Cycle
Abacavir transmembrane transport
Na+/Cl- dependent neurotransmitter transporters
Organic cation transport
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (5)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Coronary artery disease Coronary artery disease N/A N/A GWAS
Gout Gout N/A N/A GWAS
Hypertension Essential hypertension (time to event) N/A N/A GWAS
Myocardial Infarction Myocardial infarction N/A N/A GWAS
Show/Hide Text Mining Associations (59)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 15751072
Breast Neoplasms Stimulate 18550719
Burkitt Lymphoma Associate 27407111
Carcinogenesis Associate 40026294
Carcinoma Hepatocellular Associate 22439694, 26872727, 28178663, 30628708, 31953214, 36881382, 37722628
Cardiotoxicity Associate 38547766
Colonic Neoplasms Associate 35167937
Communicable Diseases Associate 35456416
Death Associate 27799064
Developmental Disabilities Associate 27799064